DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG30323

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:195 Identity:35/195 - (17%)
Similarity:65/195 - (33%) Gaps:52/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WCGGSIIAHDWVLTAEHCIGDAAS-------------VIVYFGATWR----TNAQFTHTVGNGNF 108
            :|.||:::..||:|:..|:.....             |:|:.....:    .|......:.....
  Fly    53 FCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLDES 117

  Fly   109 IKHSNADIALIRIPH----VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQ 169
            ......::||:::..    ..|..|:.:.||.|         .|...:.|||..|..|.:.....
  Fly   118 AISGCTELALLKLDRGVTGQRFAMMLPEKELNS---------TWLCNSLGWGRIYYVSYVYISAM 173

  Fly   170 CVDLQIVHNEECGW----TYGS---------VGD--------NVICTRTVDGK-SICGGDSGGPL 212
            |....:|::....|    .|.|         :.:        ..:|..:..|: ::|..|.|.||
  Fly   174 CPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSYTGRGNMCQQDLGSPL 238

  Fly   213  212
              Fly   239  238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 35/195 (18%)
Tryp_SPc 37..253 CDD:238113 35/195 (18%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 35/195 (18%)
Tryp_SPc 45..272 CDD:214473 35/195 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.