DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG30088

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:304 Identity:75/304 - (24%)
Similarity:113/304 - (37%) Gaps:91/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALAVASASAF---------DEKVFVKDL-PKA-----TKIEGRITNGYAAPEGKAPYTVGLGFS 57
            :::::||.|.:         .|:|....| |..     :.:..||..|..|....||:...|.:|
  Fly     1 MSISLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS 65

  Fly    58 GGWWCGGSIIAHDWVLTAEHCI---------------------GDAASVIVYFGATWRTN-AQFT 100
            ....|||:||:..::|||.||:                     |..:.....|.....|. .:|.
  Fly    66 SEIHCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD 130

  Fly   101 HTVGNGNFIKHSNADIALIRIPHVDFWHMVNKVELPSYNDRYN----------------NYNEWW 149
            ..:.|         ||||:::               |.|.|:|                |.:|:.
  Fly   131 RFLAN---------DIALLKL---------------SRNIRFNVHIQPICLILNPAAAPNVHEFQ 171

  Fly   150 AVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYG-SVGDNVICTRTVDGKSICGGDSGGPLV 213
            |.  |||.| :.:...:.||...|....|..|..... .:..|.:|. ...|...|.||||||||
  Fly   172 AF--GWGQT-ETNHSANVLQTTVLTRYDNRHCRSVLSMPITINQLCV-GFQGSDTCSGDSGGPLV 232

  Fly   214 T---HDG---SKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251
            |   :||   ...:|:.:| ..:.|||  |..:..|..::.|||
  Fly   233 TKVNYDGVWRYLQLGIVSF-GDDKCQS--PGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 65/258 (25%)
Tryp_SPc 37..253 CDD:238113 67/260 (26%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 65/258 (25%)
Tryp_SPc 45..273 CDD:238113 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.