DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG30083

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:254 Identity:75/254 - (29%)
Similarity:113/254 - (44%) Gaps:64/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEGRITNGYAAPEGKAPYTVGLGFSGGWW---------------CGGSIIAHDWVLTAEHCI--- 79
            |..:|.:|..|..|..|          |.               |||::|...:||:|.|||   
  Fly    30 ISPKIMHGQNAENGTNP----------WMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRD 84

  Fly    80 -------GDAASVIVYFGAT--WRTNAQFTHTVGNGNFIKHSNADIALIRI-PHVDFWHMVNKVE 134
                   |:.:| ..||..|  :| |..||    .|::   || ||.::|| |.|.|..::..:.
  Fly    85 QILAVRLGEHSS-SRYFAVTKAFR-NKYFT----TGSY---SN-DIGILRIQPIVKFNAVIRPIC 139

  Fly   135 LPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEEC-GWTYGSVGDNVICTRTV 198
            :.:...:..|...:  .|.|||.| :.......|:.|:|..::..|| ...:.:|.::.||....
  Fly   140 IITDPTKVPNVKTF--KAAGWGKT-ENETFSKVLKTVELNELNASECYNMLWVNVTESQICAGHP 201

  Fly   199 DGKSICGGDSGGPLVTH----DGS---KLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWI 250
            ||.: |.|||||||: |    |||   ..:|:.:|.||. |.|  |..:.|::..:|||
  Fly   202 DGDT-CAGDSGGPLI-HPVYMDGSLRYVQLGIISFGSSL-CNS--PGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 72/249 (29%)
Tryp_SPc 37..253 CDD:238113 74/250 (30%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 72/249 (29%)
Tryp_SPc 34..255 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.