DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG30082

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:227 Identity:54/227 - (23%)
Similarity:79/227 - (34%) Gaps:69/227 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFG 90
            :||...:|.|    |..|..|..|:...|..:....|.|::|...:||||.||:.....:.|..|
  Fly    33 NLPPTNRIVG----GRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLG 93

  Fly    91 -------------------ATWRTNAQFTHTVGNGNFIKHSNADIALIRIPHVDFWHMVNKV--- 133
                               ..:.....:.||...|.  :.|..||.|:::...    :|.|:   
  Fly    94 EYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGR--QDSRNDIGLLKLNGT----VVYKLFIR 152

  Fly   134 ---------ELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEEC------GW 183
                     ::| |:..|.        |.|| |..|.......||.|:|..:...:|      ..
  Fly   153 PICLFRDPGQVP-YSSTYE--------AAGW-GKIDLINTATVLQTVNLIRLDQSDCERSLRTSL 207

  Fly   184 TYGSVGDNVICTRTVDGK---SICGGDSGGPL 212
            :||.     .|.    |:   ..|.|||||||
  Fly   208 SYGQ-----FCA----GQWRADTCSGDSGGPL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 50/217 (23%)
Tryp_SPc 37..253 CDD:238113 50/216 (23%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 52/221 (24%)
Tryp_SPc 40..274 CDD:238113 52/220 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.