DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and Klk1b3

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:277 Identity:77/277 - (27%)
Similarity:123/277 - (44%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGS 65
            |...:..|||::....|            |..::.|:..||.......|:.|.:.:.|.:.|||.
  Rat     5 MWFLILFLALSLGRNDA------------APPVQSRVVGGYNCEMNSQPWQVAVYYFGEYLCGGV 57

  Fly    66 IIAHDWVLTAEHCIGDAASVIVYFG----------ATWRTNAQ-FTHTVGNGNFI---------K 110
            :|...||:||.||..|  :..|:.|          |..|..:| |.|...|.:.|         .
  Rat    58 LIDPSWVITAAHCATD--NYQVWLGRNNLYEDEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDD 120

  Fly   111 HSNADIALIRIPH-VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGG-TYDGSPLPDWLQCVDL 173
            :|| |:.|:.:.. .|....|..::||....:..:    ..:|.|||. |.||..|.|.||||::
  Rat   121 YSN-DLMLLHLSQPADITDGVKVIDLPIEEPKVGS----TCLASGWGSITPDGLELSDDLQCVNI 180

  Fly   174 QIVHNEECGWTY-GSVGDNVICTRTVD-GKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGC-QSG 235
            .::.||:|...: ..|.|.::|...:| ||..|.|||||||:.:  ..|.|:::: ..|.| :..
  Rat   181 DLLSNEKCVEAHKEEVTDLMLCAGEMDGGKDTCKGDSGGPLICN--GVLQGITSW-GFNPCGEPK 242

  Fly   236 APAGFQRVTYHLDWIRD 252
            .|..:.::.....||::
  Rat   243 KPGIYTKLIKFTPWIKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 69/238 (29%)
Tryp_SPc 37..253 CDD:238113 70/241 (29%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 69/238 (29%)
Tryp_SPc 29..260 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.