DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and Ctrb1

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:241 Identity:80/241 - (33%)
Similarity:110/241 - (45%) Gaps:41/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYAAPEGKAPYTVGLGFSGGW-WCGGSIIAHDWVLTAEHCIGDAASVIVYFG--------- 90
            ||.||..|..|..|:.|.|....|: :||||:|:.|||:||.|| |...|.:|..|         
  Rat    33 RIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHC-GVKTSDVVVAGEFDQGSDEE 96

  Fly    91 -------ATWRTNAQFT-HTVGNGNFIKHSNADIALIRI-PHVDFWHMVNKVELPSYNDRYNNYN 146
                   |....|.:|. .||.|         ||.|::: ....|...|:.|.||:.:|.:..  
  Rat    97 NIQVLKIAQVFKNPKFNMFTVRN---------DITLLKLATPAQFSETVSAVCLPNVDDDFPP-- 150

  Fly   147 EWWAVAC---GWGGT-YDGSPLPDWLQCVDLQIVHNEECGWTYGSVGDNVICTRTVDGKSICGGD 207
               ...|   |||.| |:....|:.||...|.||...:|..::||...:|:......|.|.|.||
  Rat   151 ---GTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVSSCMGD 212

  Fly   208 SGGPLVTH-DGS-KLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251
            ||||||.. ||. .|.|:.:: .|..|.:..||.:.|||..:.|::
  Rat   213 SGGPLVCQKDGVWTLAGIVSW-GSGVCSTSTPAVYSRVTALMPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 79/238 (33%)
Tryp_SPc 37..253 CDD:238113 79/240 (33%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 79/238 (33%)
Tryp_SPc 34..259 CDD:238113 79/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.