DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and TPSD1

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:243 Identity:73/243 - (30%)
Similarity:108/243 - (44%) Gaps:51/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWW---CGGSI 66
            |.:|||.|.::.|     :|...|.....:..|..|..||..|.|:.|.|...|.:|   ||||:
Human    11 LLLLALPVLASPA-----YVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSL 70

  Fly    67 IAHDWVLTAEHC----IGDAASVIV-------YFG------ATWRTNAQFTHTVGNGNFIKHSNA 114
            |...|||||.||    |.|.|::.|       |:.      :....:.||        :|..:.|
Human    71 IHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQF--------YIIQTGA 127

  Fly   115 DIALIRIPH-VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGS---PLPDWLQCVDLQI 175
            ||||:.:.. |:....::.|.||..::.:......|..  |||.. |.:   |.|..|:.|::.:
Human   128 DIALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVT--GWGDV-DNNVHLPPPYPLKEVEVPV 189

  Fly   176 VHNEEC----------GWTYGSVGDNVICTRTVDGKSICGGDSGGPLV 213
            |.|..|          |.::..|.|:::|..:.:..| |.||||||||
Human   190 VENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENHDS-CQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 65/212 (31%)
Tryp_SPc 37..253 CDD:238113 65/211 (31%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 65/211 (31%)
Tryp_SPc 38..240 CDD:214473 65/211 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.