DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and F9

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:246 Identity:65/246 - (26%)
Similarity:109/246 - (44%) Gaps:34/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFT 100
            |:..|..|..|:.|:.|.|......:|||||:...|::||.||:.....:.|..|   ..|.:.|
Human   226 RVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAG---EHNIEET 287

  Fly   101 -HTVGNGNFIK----HS--------NADIALIRIPHVDFWHMVNKVELP------SYNDRYNNYN 146
             ||....|.|:    |:        |.||||:.:   |...::|....|      .|.:.:..:.
Human   288 EHTEQKRNVIRIIPHHNYNAAINKYNHDIALLEL---DEPLVLNSYVTPICIADKEYTNIFLKFG 349

  Fly   147 EWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEEC-GWTYGSVGDNVICTRTVD-GKSICGGDSG 209
            ..:  ..|||..:........||.:.:.:|....| ..|..::.:|:.|....: |:..|.||||
Human   350 SGY--VSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSG 412

  Fly   210 GPLVTH-DG-SKLVGVSNFVSSNGCQSGAPAG-FQRVTYHLDWIRDHTGIS 257
            ||.||. :| |.|.|:.::  ...|......| :.:|:.:::||::.|.::
Human   413 GPHVTEVEGTSFLTGIISW--GEECAMKGKYGIYTKVSRYVNWIKEKTKLT 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 62/237 (26%)
Tryp_SPc 37..253 CDD:238113 63/239 (26%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 63/239 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.