DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and T22A3.6

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:140 Identity:30/140 - (21%)
Similarity:48/140 - (34%) Gaps:60/140 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 HMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYGSVGDNV 192
            :.:|:: ||   |.|.|:       |   ...|.:||..|  |.                ||::.
 Worm   132 YSMNRI-LP---DEYENF-------C---RNPDKNPLGPW--CY----------------VGNDT 164

  Fly   193 I------CTRTVDGKS--ICGGDSGGPLVTHDGS------KLVGV---------SNFVSSNGCQS 234
            .      |..:.:..|  :|....|.|...:|.|      :|:|:         |.||..:    
 Worm   165 TAPCFQPCRPSTETSSDFVCLNRDGFPYTDYDMSDILDLPQLIGIFKDVDLMYESRFVLPS---- 225

  Fly   235 GAPAGFQRVT 244
             .|.|.||::
 Worm   226 -LPDGVQRLS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 30/140 (21%)
Tryp_SPc 37..253 CDD:238113 30/140 (21%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 14/72 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.