DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and try-5

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:213 Identity:53/213 - (24%)
Similarity:74/213 - (34%) Gaps:67/213 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGSIIAHDWVLTAEHCI----------GDAASVIVYFGATWRTNAQFTH---------TVG--- 104
            |||::|....||||.||.          |:..|:   .|....:|.:||.         |||   
 Worm    73 CGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSM---SGRYCESNQRFTDSEILTRTVVTVGAMC 134

  Fly   105 --------------NGNFIKHSNADIALIRIPHVDFWHMVNKVELPSYNDRYNNYNEWWAVAC-- 153
                          ||..:|.|...|......|.:..:.:..:||.|..|.....|    .||  
 Worm   135 TRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELESTIDDVEGAN----YACLP 195

  Fly   154 ----------------GWGGT----YDGSPLPDWLQCVDLQIVHNEECGWTYG-SVGDNVICTRT 197
                            |||..    :|.:..| .:|.:.|.......|...:| |:..:..||..
 Worm   196 FLPEVNIQSGANVTSFGWGSDPGKGFDNAAFP-MIQVLTLATETLATCEENWGTSIPFDSFCTAE 259

  Fly   198 VDGKSICGGDSGGPLVTH 215
            .:.|::|.|||||.|..|
 Worm   260 EEDKNVCSGDSGGGLTFH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 53/213 (25%)
Tryp_SPc 37..253 CDD:238113 53/213 (25%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 53/213 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.