DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and try-10

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:321 Identity:70/321 - (21%)
Similarity:102/321 - (31%) Gaps:123/321 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAA---------------PEGKAPY 50
            |..|:.:|:....|.|                    |.||::|               |:|    
 Worm    59 MNFFILLLSFISYSTS--------------------IINGFSANSFDTLSLASVITRFPDG---- 99

  Fly    51 TVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFT--------HTVGNGN 107
            |..:       |||.:||...|:|:.||        |:.|..:...|:.|        |..|...
 Worm   100 TTNV-------CGGVLIAPSIVITSAHC--------VFSGDDFAVTAKVTLGDVHLNKHDDGEQE 149

  Fly   108 FIKH--------------SNADIALIRIP-HVDFWH---MVNKVELPSYNDRYNNYNEWWAV--- 151
            |..|              :|.|:|:|.:| ..|..|   .:...:|||...  .|:.|...:   
 Worm   150 FRSHAMAISKKFFNDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGS--VNFKETAPLTQL 212

  Fly   152 --------ACGWGGT------YDGSPLPDWLQCVDLQIVHNEECGWTYGSVGD-NVICTRTVDGK 201
                    ..|||.|      |..|             |.......:...:|. ..:..:.|.|.
 Worm   213 QLETSVCYVAGWGKTENKTAKYSDS-------------VRQMMVNLSVRRIGKRKYLIAKAVTGS 264

  Fly   202 S-ICGGDSGGPLVTHDGSK--LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRD--HTGIS 257
            | .|.||||.|:......|  |||....:.|....|.     |..:.|:.:.||  :|.:|
 Worm   265 SRACMGDSGSPVYCFVNGKRILVGTVAHIGSFSKMSE-----QDPSNHISFCRDFEYTFVS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 61/275 (22%)
Tryp_SPc 37..253 CDD:238113 63/279 (23%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 57/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.