DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CTRL

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:240 Identity:78/240 - (32%)
Similarity:111/240 - (46%) Gaps:28/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ATKIEGRITNGYAAPEGKAPYTVGLGFSGGW-WCGGSIIAHDWVLTAEHCIGDAASVIVYFGATW 93
            |.....||.||..|..|..|:.|.|..|.|: :||||:|:..||:||.||........|..|...
Human    27 ALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYD 91

  Fly    94 R-TNAQFTHTVGNGNFIKH-------SNADIALIRIPH-VDFWHMVNKVELPSYNDRYNNYNEWW 149
            | :||:....:.....|.|       .|.|:.|:::.. ..:...::.|.|.|.|:....     
Human    92 RSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTE----- 151

  Fly   150 AVAC---GWG---GTYDGSPLPDWLQCVDLQIVHNEECGWTYG-SVGDNVICTRTVDGKSICGGD 207
            .:.|   |||   |.  |:..|..||.|.|.:|...:|...:| |:.|::||.... |.|.|.||
Human   152 GLTCVTTGWGRLSGV--GNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGA-GASSCQGD 213

  Fly   208 SGGPLVTHDGSK--LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWI 250
            ||||||...|:.  |:|:.::.:.| |...|||.:.||:....||
Human   214 SGGPLVCQKGNTWVLIGIVSWGTKN-CNVRAPAVYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 75/232 (32%)
Tryp_SPc 37..253 CDD:238113 76/233 (33%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.