DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG43336

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:252 Identity:70/252 - (27%)
Similarity:103/252 - (40%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYAAPEGKAPYTVGL-GFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQF 99
            |:.||..|....:|:...| ...|.:.||||:|.:..||||.||..|...::...|...|...:.
  Fly    37 RVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLTAAHCFLDRTELVARLGEYDREEYEM 101

  Fly   100 TH----------TVGNGNFIKHSNA-----DIALIRIPHVDFWHMVNKVELPSYND--------- 140
            .|          .|..|...:|.|.     |||::|        :..||:   |.|         
  Fly   102 CHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILR--------LYRKVQ---YTDNIRPICIVI 155

  Fly   141 --RYNNYNEWW--AVACGWGGT-YDGSPLPDWLQCVDLQIVHNEEC-GWTYGSVGDNVICTRTVD 199
              |:..|.:..  ....|||.| .:|....  |:.|||...|.|.| .:...|:..|..|... :
  Fly   156 DPRWRKYIDSLDPLTGTGWGKTESEGDSAK--LRTVDLARKHPEVCRRYATLSLTANQFCAGN-E 217

  Fly   200 GKSICGGDSGGP---LVTHDGSK---LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWI 250
            ..::|.||||||   |:.:..||   .||:::|.::   |....:.|..|..::|||
  Fly   218 RSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNT---QCVMVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 68/250 (27%)
Tryp_SPc 37..253 CDD:238113 69/251 (27%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 68/250 (27%)
Tryp_SPc 40..271 CDD:238113 67/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.