DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and Cela1

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:287 Identity:81/287 - (28%)
Similarity:114/287 - (39%) Gaps:67/287 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFS-GGWW---CGG 64
            ||...:|.:...|       .:|:|:.   :.|:..|..|.....|..:.|.:. ||.|   |||
Mouse     4 FLVFASLVLCGHS-------TEDVPET---DARVVGGAEARRNSWPSQISLQYQYGGSWHHTCGG 58

  Fly    65 SIIAHDWVLTAEHCIGDAASVIVYF---------GATWRTNAQ--FTHTVGNGNFIKHSNADIAL 118
            ::|..:||:||.||:....:..|..         |.....|.|  .:|...|.|.:. :..||||
Mouse    59 TLIRSNWVMTAAHCVDSPMTYRVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVV-AGYDIAL 122

  Fly   119 IRIPHVDFWHMVNKVELPSYNDRYNNY--------------NEWWAVACGWGGTYDGSPLPDWLQ 169
            :|        :...|.|       |||              |.......|||.|.....|...||
Mouse   123 LR--------LAKSVTL-------NNYVQLGVLPREGTILANNSPCYITGWGRTRTNGELAQTLQ 172

  Fly   170 CVDLQIVHNEECG----WTYGSVGDNVICTRTVDGKSICGGDSGGPLVTH---DGSKLV-GVSNF 226
            ...|..|....|.    |. .||.:.::|......:|.|.|||||||  |   :|...| ||::|
Mouse   173 QAYLPSVSYSICSSSSYWG-SSVKNTMVCAGGDGVRSGCQGDSGGPL--HCMVNGQYAVHGVTSF 234

  Fly   227 VSSNGCQ-SGAPAGFQRVTYHLDWIRD 252
            |||.||. :..|..|.||:.::.|:.:
Mouse   235 VSSMGCNVARKPTVFTRVSAYISWMNN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 74/251 (29%)
Tryp_SPc 37..253 CDD:238113 74/254 (29%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 74/250 (30%)
Tryp_SPc 27..262 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.