DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG42694

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:229 Identity:53/229 - (23%)
Similarity:83/229 - (36%) Gaps:57/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GW----------WCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNGNFIKHS- 112
            ||          .|.||:|:..:||:|..||.....:.|..|.:..|.:...:||.|.....|| 
  Fly    45 GWLAHISNGTHVLCSGSLISKQFVLSAAQCIDVHGKLFVQLGVSNATKSPHWYTVSNVVIPSHSG 109

  Fly   113 ---NADIALIRIPHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYD------GSPLPDWL 168
               ..||.|:::               |.:..||::.....:|.. ..|.|      ......||
  Fly   110 KRLQRDIGLLKL---------------SQSVDYNDFVYPICIALN-TNTLDMVKILQNFTTSAWL 158

  Fly   169 ------QCVDLQIVHNEECGWTY-GSVGDNVICTRTVDGKSICGGDSGG----PLVTHDGSKLV- 221
                  |.:.|..:..:.|.... |:|....||..::...:.|..|||.    |::  .||.:| 
  Fly   159 SKNKNPQTIVLSQLSRDRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPII--QGSNIVR 221

  Fly   222 ----GVSNFVSSNG-CQSGAPAGFQRVTYHLDWI 250
                |:..:|:... |..  ||.:..|...:.||
  Fly   222 EMLFGIRGYVNGRSWCSE--PAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 51/227 (22%)
Tryp_SPc 37..253 CDD:238113 53/229 (23%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 52/228 (23%)
Tryp_SPc 46..253 CDD:214473 50/226 (22%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.