DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and VFB1

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_175151.1 Gene:VFB1 / 841121 AraportID:AT1G47056 Length:518 Species:Arabidopsis thaliana


Alignment Length:395 Identity:89/395 - (22%)
Similarity:132/395 - (33%) Gaps:147/395 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GQPTRTAS----------------PRPLVTASIAAP---RSLFDVCWDDVLIPQVAVYLSLKDLF 64
            ||.|..|.                |...:.:.|:.|   .||.|.|        :|:.....:..
plant     2 GQSTSAAGNSILNRRRSKSFTLKFPIESIESEISQPDYTSSLPDEC--------LALVFQFLNSG 58

  Fly    65 NLRCCSRTAQRF--VEAALEKRQELHLSGNNTKNI-------DVAFRVLARC------------- 107
            |.:.|:...:|:  ||.....|..||...:...:|       |...::..:|             
plant    59 NRKRCALVCRRWMIVEGQNRYRLSLHARSDLITSIPSLFSRFDSVTKLSLKCDRRSVSIGDEALV 123

  Fly   108 -----CQRLEVLHLACCRWLTDELLLPLLANNK--------------KRLWAVNLNECVNITALS 153
                 |:.|:.|.|..||.|||..:.....|.|              |.:.|| |:.|.|:..||
plant   124 KISLRCRNLKRLKLRACRELTDVGMAAFAENCKDLKIFSCGSCDFGAKGVKAV-LDHCSNLEELS 187

  Fly   154 LQ-------------------------------------PIIVECKELRVLKLSKCQWLTTGAVD 181
            ::                                     |:||..|.|:.|||.:|    :|..|
plant   188 IKRLRGFTDIAPEMIGPGVAASSLKSICLKELYNGQCFGPVIVGAKNLKSLKLFRC----SGDWD 248

  Fly   182 AL------------TLHQSKLVEFD-----ISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTD 229
            .|            .:|..::...|     ||||               :.|..|.|..||..|:
plant   249 LLLQEMSGKDHGVVEIHLERMQVSDVALSAISYC---------------SSLESLHLVKTPECTN 298

  Fly   230 QVLIQIGNYCRELEHINVIGCAA--ISDYGVHALTVHCLRLRTL-LIRRCPRVTELSLAPLRQRR 291
            ..|..|...|:.|..:::.|..|  |.|.|:.|:...|.:|:.| ||...|  |.|||..|..:.
plant   299 FGLAAIAEKCKRLRKLHIDGWKANLIGDEGLVAVAKFCSQLQELVLIGVNP--TTLSLGMLAAKC 361

  Fly   292 LYIDR 296
            |.::|
plant   362 LNLER 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 6/49 (12%)
AMN1 96..>261 CDD:187754 55/259 (21%)
leucine-rich repeat 111..137 CDD:275381 10/39 (26%)
leucine-rich repeat 138..163 CDD:275381 10/61 (16%)
leucine-rich repeat 164..189 CDD:275381 9/36 (25%)
leucine-rich repeat 190..215 CDD:275381 5/29 (17%)
leucine-rich repeat 216..241 CDD:275381 9/24 (38%)
leucine-rich repeat 242..267 CDD:275381 8/26 (31%)
leucine-rich repeat 268..290 CDD:275381 10/22 (45%)
VFB1NP_175151.1 F-box-like 41..>70 CDD:403981 7/36 (19%)
AMN1 87..>202 CDD:187754 22/115 (19%)
leucine-rich repeat 103..125 CDD:275381 1/21 (5%)
leucine-rich repeat 132..157 CDD:275381 9/24 (38%)
leucine-rich repeat 158..182 CDD:275381 5/24 (21%)
leucine-rich repeat 183..224 CDD:275381 2/40 (5%)
leucine-rich repeat 235..260 CDD:275381 8/28 (29%)
leucine-rich repeat 261..284 CDD:275381 6/37 (16%)
AMN1 271..>412 CDD:187754 34/113 (30%)
leucine-rich repeat 285..310 CDD:275381 9/24 (38%)
leucine-rich repeat 311..338 CDD:275381 8/26 (31%)
leucine-rich repeat 339..363 CDD:275381 10/25 (40%)
leucine-rich repeat 364..389 CDD:275381 1/3 (33%)
leucine-rich repeat 390..414 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.