DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and AT5G52480

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_200061.3 Gene:AT5G52480 / 835324 AraportID:AT5G52480 Length:241 Species:Arabidopsis thaliana


Alignment Length:212 Identity:50/212 - (23%)
Similarity:79/212 - (37%) Gaps:38/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PLLANNKKRLW--AVNLNEC----VNITAL---SLQPIIVE-CKELRVLKLSKCQWLTTGAVDAL 183
            |:|.||.:.:.  ||:.:|.    :||...   ||...|.| ...||.|:| .|..:|.......
plant     9 PVLVNNPEAICRNAVDRSEGGLLEINIGDFGSDSLLTYIAERSSNLRSLRL-MCSEITDDGFVQA 72

  Fly   184 TLHQSKLVEFDISYCGAIGE-------RCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRE 241
            .:....|.|.::|.....||       .|..:....||:|..||..:    .|...|.|.....:
plant    73 VVKLPMLEELEVSGISLSGESMKLAGLSCPNLKTLMLNRLFYLSSDD----DDHDAIAIAESMPK 133

  Fly   242 LEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRC----PRVTELSLAPLRQRRLYIDRPQPDVG 302
            |.|:.:.| ..::..|::|:...|..|..|.:|:|    ..:.:.....::..|.:.|....|  
plant   134 LRHLQLCG-NKLTKTGLNAILDGCPHLEHLDLRQCINLVGNLEKRCFEKIKDLRRHNDSTSAD-- 195

  Fly   303 LNAYNLNDFYPSDFLVY 319
                     ||..|..|
plant   196 ---------YPFSFETY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381
AMN1 96..>261 CDD:187754 37/148 (25%)
leucine-rich repeat 111..137 CDD:275381 4/7 (57%)
leucine-rich repeat 138..163 CDD:275381 9/34 (26%)
leucine-rich repeat 164..189 CDD:275381 6/24 (25%)
leucine-rich repeat 190..215 CDD:275381 7/31 (23%)
leucine-rich repeat 216..241 CDD:275381 6/24 (25%)
leucine-rich repeat 242..267 CDD:275381 6/24 (25%)
leucine-rich repeat 268..290 CDD:275381 4/25 (16%)
AT5G52480NP_200061.3 AMN1 <40..167 CDD:187754 33/132 (25%)
leucine-rich repeat 54..78 CDD:275381 6/24 (25%)
leucine-rich repeat 79..103 CDD:275381 6/23 (26%)
leucine-rich repeat 134..158 CDD:275381 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.