DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and AT5G21900

DIOPT Version :10

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_680178.1 Gene:AT5G21900 / 832250 AraportID:AT5G21900 Length:544 Species:Arabidopsis thaliana


Alignment Length:231 Identity:62/231 - (26%)
Similarity:103/231 - (44%) Gaps:33/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VYLSLKDLFNLRC-CSRTAQRFVEAALEKRQELHLSGNNTKN--IDVAFRVLARCCQRLEVLHLA 117
            |.|...||..:.| |.|.:.:.:        .|.|.|.:..:  |:..|:........|..|.|.
plant   207 VQLVEDDLVKIFCDCDRVSLKVL--------ILDLCGRSMTDYTINQFFKRAPNGFPSLTTLSLQ 263

  Fly   118 CCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVE--CKELRVLKLSKCQWLTTGAV 180
            ....|||..|| |::.:...|..:||.||..:|..:|: |:.:  ...||.|.:..||       
plant   264 GAFCLTDNALL-LISKSSPLLQYINLTECSLLTYRALR-ILADKFGSTLRGLSIGGCQ------- 319

  Fly   181 DALTLHQ---SKLVEFD----ISYCGAIGERCLII---FFRKLNKLTVLSLANTPSVTDQVLIQI 235
             .:..|:   |.|.:|:    :|..|.:.....::   |..:.:.||.|||||...|||:.:..|
plant   320 -GIKKHKGFSSSLYKFEKLNYLSVAGLVSVNDGVVRSFFMFRSSILTDLSLANCNEVTDECMWHI 383

  Fly   236 GNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTL 271
            |.||::||.:::.....::|..:..:|..|..|::|
plant   384 GRYCKKLEALDITDLDKLTDKSLEFITEGCRYLKSL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 F-box_FBXL15 41..84 CDD:438898 7/28 (25%)
leucine-rich repeat 85..110 CDD:275381 5/26 (19%)
AMN1 96..>261 CDD:187754 48/178 (27%)
leucine-rich repeat 111..137 CDD:275381 9/25 (36%)
leucine-rich repeat 138..163 CDD:275381 8/26 (31%)
leucine-rich repeat 164..189 CDD:275381 6/27 (22%)
leucine-rich repeat 190..215 CDD:275381 5/31 (16%)
leucine-rich repeat 216..241 CDD:275381 14/24 (58%)
leucine-rich repeat 242..267 CDD:275381 5/24 (21%)
leucine-rich repeat 268..290 CDD:275381 2/4 (50%)
AT5G21900NP_680178.1 AMN1 221..405 CDD:187754 53/201 (26%)
leucine-rich repeat 228..244 CDD:275381 3/23 (13%)
leucine-rich repeat 257..282 CDD:275381 9/25 (36%)
leucine-rich repeat 283..309 CDD:275381 8/26 (31%)
leucine-rich repeat 310..354 CDD:275381 11/51 (22%)
AMN1 <357..507 CDD:187754 22/63 (35%)
leucine-rich repeat 364..389 CDD:275381 14/24 (58%)
leucine-rich repeat 390..415 CDD:275381 5/24 (21%)
leucine-rich repeat 416..441 CDD:275381 2/4 (50%)
leucine-rich repeat 442..467 CDD:275381
leucine-rich repeat 468..493 CDD:275381
leucine-rich repeat 494..516 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.