DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and AT4G03630

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_192272.1 Gene:AT4G03630 / 825663 AraportID:AT4G03630 Length:220 Species:Arabidopsis thaliana


Alignment Length:180 Identity:52/180 - (28%)
Similarity:74/180 - (41%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DELL--LPLLANNKKRL-----WAVNLNE--CVNI------TALSLQPIIVECKELRVLKLSKCQ 173
            ||||  :...::..|||     .||.|::  ||.|      |...|..|......||.|.|:||.
plant     9 DELLTFVAYRSSILKRLGRMMCHAVALSQGGCVEINIEHFGTDSLLTYIADRSSNLRHLGLAKCD 73

  Fly   174 WLTTGAVDALTLHQSKLVEFDISYC-------GAIGERCLIIFFRKLN----KLTVLSLANTPSV 227
            .:|...:....:....|.:.::|||       .|||..||.:...|||    |.        |..
plant    74 QITGMGLFTEAMKLPLLEDLELSYCLIKGKNLEAIGFACLHLKTLKLNCQGFKF--------PGF 130

  Fly   228 T-DQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRC 276
            | |...:.|.....||..:.:.| ..:||.|::|:...|..|..|.:|:|
plant   131 TYDHDALGIAKRMPELRCLQLFG-NRVSDVGLNAIFDGCPHLEHLDLRQC 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381
AMN1 96..>261 CDD:187754 46/163 (28%)
leucine-rich repeat 111..137 CDD:275381 4/14 (29%)
leucine-rich repeat 138..163 CDD:275381 10/37 (27%)
leucine-rich repeat 164..189 CDD:275381 7/24 (29%)
leucine-rich repeat 190..215 CDD:275381 12/35 (34%)
leucine-rich repeat 216..241 CDD:275381 4/25 (16%)
leucine-rich repeat 242..267 CDD:275381 7/24 (29%)
leucine-rich repeat 268..290 CDD:275381 4/9 (44%)
AT4G03630NP_192272.1 AMN1 <39..179 CDD:187754 41/148 (28%)
leucine-rich repeat 64..89 CDD:275381 7/24 (29%)
leucine-rich repeat 90..114 CDD:275381 8/23 (35%)
leucine-rich repeat 115..145 CDD:275381 8/37 (22%)
leucine-rich repeat 146..170 CDD:275381 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.