DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and AT3G58530

DIOPT Version :10

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_567069.1 Gene:AT3G58530 / 825022 AraportID:AT3G58530 Length:353 Species:Arabidopsis thaliana


Alignment Length:243 Identity:67/243 - (27%)
Similarity:108/243 - (44%) Gaps:23/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LSLKDLFNLRCCSRTAQRFVEAALEKRQELHLSGN--NTKNIDVAFRVLARCCQRLEVLHLACCR 120
            |||:.| ||..|.:.:...:||......:|.:...  |.:..|...|.|.:.|:.:..|:|:.|:
plant   111 LS
LEWL-NLNVCQKISDNGIEAITSICPKLKVFSIYWNVRVTDAGIRNLVKNCRHITDLNLSGCK 174

  Fly   121 WLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTL 185
            .|||: .:.|:|.:...|.::|:..||.||...|..::.:|..|:.|.|    :..:|..|...:
plant   175 SLTDK-SMQLVAESYPDLESLNITRCVKITDDGLLQVLQKCFSLQTLNL----YALSGFTDKAYM 234

  Fly   186 HQSKLVEFD-ISYCGA-------IGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCREL 242
            ..|.|.:.. :..|||       ||.      ..|.|||..|:|.....:||..:..|.|.|..|
plant   235 KISLLADLRFLDICGAQNISDEGIGH------IAKCNKLESLNLTWCVRITDAGVNTIANSCTSL 293

  Fly   243 EHINVIGCAAISDYGVHALTVHC-LRLRTLLIRRCPRVTELSLAPLRQ 289
            |.:::.|...::|..:..|:..| ..|.||.:..|..:...|...|.|
plant   294 EFLSLFGIVGVTDRCLETLSQTCSTTLTTLDVNGCTGIKRRSREELLQ 341

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 F-box_FBXL15 41..84 CDD:438898 9/25 (36%)
leucine-rich repeat 85..110 CDD:275381 6/26 (23%)
AMN1 96..>261 CDD:187754 47/172 (27%)
leucine-rich repeat 111..137 CDD:275381 8/25 (32%)
leucine-rich repeat 138..163 CDD:275381 8/24 (33%)
leucine-rich repeat 164..189 CDD:275381 5/24 (21%)
leucine-rich repeat 190..215 CDD:275381 7/32 (22%)
leucine-rich repeat 216..241 CDD:275381 8/24 (33%)
leucine-rich repeat 242..267 CDD:275381 6/25 (24%)
leucine-rich repeat 268..290 CDD:275381 7/22 (32%)
AT3G58530NP_567069.1 leucine-rich repeat 30..55 CDD:275381
leucine-rich repeat 56..75 CDD:275381