| Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001339797.3 | Gene: | kdm2ab / 799441 | ZFINID: | ZDB-GENE-101007-5 | Length: | 1263 | Species: | Danio rerio |
| Alignment Length: | 259 | Identity: | 59/259 - (22%) |
|---|---|---|---|
| Similarity: | 110/259 - (42%) | Gaps: | 71/259 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 22 TRTASPRPLVTASIAAPRSLFDVCWDDVLIPQVAVYLS----LKDLFNLRCCSRTAQRFVEAALE 82
Fly 83 KRQELHLSGNNTKNIDVAFRVLARCCQRLEVLHLACCRWLTD----ELLLPLLANNKKR------ 137
Fly 138 LWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTL----HQSKLVEFDISYC 198
Fly 199 GAIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAA-ISDYGVHAL 261 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 5/24 (21%) |
| AMN1 | 96..>261 | CDD:187754 | 42/179 (23%) | ||
| leucine-rich repeat | 111..137 | CDD:275381 | 9/29 (31%) | ||
| leucine-rich repeat | 138..163 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 164..189 | CDD:275381 | 9/28 (32%) | ||
| leucine-rich repeat | 190..215 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 216..241 | CDD:275381 | 3/24 (13%) | ||
| leucine-rich repeat | 242..267 | CDD:275381 | 6/21 (29%) | ||
| leucine-rich repeat | 268..290 | CDD:275381 | |||
| kdm2ab | XP_001339797.3 | JmjC | 150..221 | CDD:214721 | |
| cupin_like | 197..297 | CDD:304367 | |||
| zf-CXXC | <524..558 | CDD:251032 | |||
| PHD_4 | 563..624 | CDD:293471 | |||
| F-box-like | 1002..1042 | CDD:289689 | |||
| leucine-rich repeat | 1036..1060 | CDD:275381 | 5/16 (31%) | ||
| leucine-rich repeat | 1061..1084 | CDD:275381 | 3/22 (14%) | ||
| AMN1 | 1075..1230 | CDD:187754 | 45/205 (22%) | ||
| leucine-rich repeat | 1085..1108 | CDD:275381 | 9/49 (18%) | ||
| leucine-rich repeat | 1109..1142 | CDD:275381 | 9/32 (28%) | ||
| leucine-rich repeat | 1143..1167 | CDD:275381 | 7/27 (26%) | ||
| leucine-rich repeat | 1197..1216 | CDD:275381 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||