DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and fbxl17

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_001335097.5 Gene:fbxl17 / 795023 ZFINID:ZDB-GENE-111013-3 Length:409 Species:Danio rerio


Alignment Length:249 Identity:47/249 - (18%)
Similarity:98/249 - (39%) Gaps:72/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CCSRTAQRFVEAALEKRQELHLSGNNTKNIDVAF------RVLARCCQRLEV------LHLACCR 120
            ||.:|         |..:|:    .:|:|.|.:.      .:|.:....|.|      ..|.|..
Zfish   200 CCCQT---------EASEEI----KSTENTDTSHINQLPSSILLKVFSHLSVKERCLAASLVCKY 251

  Fly   121 W--------------------LTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELR 165
            |                    :.|:||:. :|:.::.:..:|:::|.|:....:..:...|..|.
Zfish   252 WRDLCLDFQFWKQIDLSGLQQVKDDLLVK-IASRRQNVTEINISDCRNVQDHGVCALASNCAGLI 315

  Fly   166 VLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQ 230
            .....:|:.|:..::..:.:|                  |.:     |.|:.|   .|...:||.
Zfish   316 KYTAYRCKQLSDVSLSTVAIH------------------CPL-----LQKVHV---GNQDKLTDH 354

  Fly   231 VLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRCPRVTELSL 284
            .|..:|::|:||:.::...|.:|||.|:.:|...|.:|:.:.::....|::..:
Zfish   355 ALKLLGDHCKELKDVHFGQCYSISDEGLMSLAQGCNKLQRIYMQENKLVSQAGI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 5/30 (17%)
AMN1 96..>261 CDD:187754 37/196 (19%)
leucine-rich repeat 111..137 CDD:275381 9/51 (18%)
leucine-rich repeat 138..163 CDD:275381 4/24 (17%)
leucine-rich repeat 164..189 CDD:275381 4/24 (17%)
leucine-rich repeat 190..215 CDD:275381 2/24 (8%)
leucine-rich repeat 216..241 CDD:275381 7/24 (29%)
leucine-rich repeat 242..267 CDD:275381 8/24 (33%)
leucine-rich repeat 268..290 CDD:275381 2/17 (12%)
fbxl17XP_001335097.5 F-box-like 221..268 CDD:289689 6/46 (13%)
AMN1 257..>397 CDD:187754 32/166 (19%)
leucine-rich repeat 262..287 CDD:275381 4/25 (16%)
leucine-rich repeat 288..313 CDD:275381 4/24 (17%)
leucine-rich repeat 314..339 CDD:275381 5/42 (12%)
leucine-rich repeat 340..365 CDD:275381 9/27 (33%)
leucine-rich repeat 366..391 CDD:275381 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.