| Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_848739.1 | Gene: | Fbxl2 / 72179 | MGIID: | 1919429 | Length: | 423 | Species: | Mus musculus |
| Alignment Length: | 252 | Identity: | 67/252 - (26%) |
|---|---|---|---|
| Similarity: | 105/252 - (41%) | Gaps: | 38/252 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 62 DLFNLRCCSRTAQRFVEAALEKRQELHLSGNNTKNIDVAFRVLARCCQRLEVLHLACCRWLTDEL 126
Fly 127 LLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLV 191
Fly 192 EFDISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDY 256
Fly 257 GV-HALTVHC--LRLRTLLIRRCPRVTELSLAPLRQRRLYIDRPQPDVGLNAYNLND 310 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 3/24 (13%) |
| AMN1 | 96..>261 | CDD:187754 | 46/165 (28%) | ||
| leucine-rich repeat | 111..137 | CDD:275381 | 9/25 (36%) | ||
| leucine-rich repeat | 138..163 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 164..189 | CDD:275381 | 10/24 (42%) | ||
| leucine-rich repeat | 190..215 | CDD:275381 | 3/24 (13%) | ||
| leucine-rich repeat | 216..241 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 242..267 | CDD:275381 | 7/27 (26%) | ||
| leucine-rich repeat | 268..290 | CDD:275381 | 9/21 (43%) | ||
| Fbxl2 | NP_848739.1 | F-box-like | 15..57 | CDD:289689 | |
| leucine-rich repeat | 52..79 | CDD:275381 | |||
| LRR 1 | 61..87 | ||||
| AMN1 | <76..223 | CDD:187754 | 22/88 (25%) | ||
| leucine-rich repeat | 80..99 | CDD:275381 | |||
| Interaction with Calmodulin. /evidence=ECO:0000269|PubMed:21343341 | 80..90 | ||||
| LRR 2 | 88..113 | ||||
| leucine-rich repeat | 106..131 | CDD:275381 | |||
| LRR 3 | 114..139 | ||||
| leucine-rich repeat | 132..157 | CDD:275381 | |||
| LRR 4 | 140..165 | 2/5 (40%) | |||
| leucine-rich repeat | 158..183 | CDD:275381 | 8/47 (17%) | ||
| LRR 5 | 166..191 | 9/48 (19%) | |||
| AMN1 | 168..367 | CDD:187754 | 60/233 (26%) | ||
| leucine-rich repeat | 184..209 | CDD:275381 | 9/25 (36%) | ||
| LRR 6 | 192..217 | 9/25 (36%) | |||
| leucine-rich repeat | 210..235 | CDD:275381 | 8/24 (33%) | ||
| LRR 7 | 218..243 | 8/24 (33%) | |||
| leucine-rich repeat | 236..261 | CDD:275381 | 10/24 (42%) | ||
| LRR 8 | 244..269 | 7/24 (29%) | |||
| leucine-rich repeat | 262..287 | CDD:275381 | 3/24 (13%) | ||
| LRR 9 | 270..295 | 4/24 (17%) | |||
| leucine-rich repeat | 288..313 | CDD:275381 | 7/24 (29%) | ||
| LRR 10 | 296..321 | 6/24 (25%) | |||
| leucine-rich repeat | 314..336 | CDD:275381 | 6/21 (29%) | ||
| LRR 11 | 322..350 | 10/27 (37%) | |||
| leucine-rich repeat | 343..362 | CDD:275381 | 8/18 (44%) | ||
| LRR 12 | 351..375 | 10/33 (30%) | |||
| LRR 13 | 376..401 | 67/252 (27%) | |||
| CAAX motif | 420..423 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||