DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and Fbxo39

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006533964.2 Gene:Fbxo39 / 628100 MGIID:3505735 Length:480 Species:Mus musculus


Alignment Length:217 Identity:39/217 - (17%)
Similarity:69/217 - (31%) Gaps:82/217 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 LHQSKLVEFDISY-------CGA-IGERCLIIFF---------------RKLNKL---------T 217
            :||..|::.|...       |.| :.:.||...|               ||.|::         .
Mouse    32 VHQGPLMDEDCEVTQLQEQSCWATLPDVCLRRVFWWLGDRDRSRAALVCRKWNQIMYSADLWRYR 96

  Fly   218 VLSLANTPSVT-----DQVLIQIGNYCRELEHINV---------------------IGCAAISDY 256
            .::.:..||..     :..|..|..:.|.|||:.:                     :.|...|:.
Mouse    97 TITFSGRPSRVHASEFESALWYIKKFGRYLEHLEIKFLNPYNAVLTKKFQVTMRGLLSCLGKSNN 161

  Fly   257 GVHALTVHCLRLRTLLIRRCPR---VTELSL-----------APLRQRRLYIDR----------P 297
            .:.:|::..|.|..|:.|...|   :..||.           ..|:..||.:::          .
Mouse   162 RLRSLSIQHLELDRLVWRNSIRGSLIKSLSFFLKKMGKHLDHLSLKGARLTVEQGCHILNSLSYM 226

  Fly   298 QPDVGLNAYNLNDFYPSDFLVY 319
            |.:...:..|:.||:.....||
Mouse   227 QNENMASELNIEDFFSHHLAVY 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381
AMN1 96..>261 CDD:187754 22/133 (17%)
leucine-rich repeat 111..137 CDD:275381
leucine-rich repeat 138..163 CDD:275381
leucine-rich repeat 164..189 CDD:275381 2/3 (67%)
leucine-rich repeat 190..215 CDD:275381 9/47 (19%)
leucine-rich repeat 216..241 CDD:275381 4/38 (11%)
leucine-rich repeat 242..267 CDD:275381 6/45 (13%)
leucine-rich repeat 268..290 CDD:275381 7/35 (20%)
Fbxo39XP_006533964.2 F-box-like 53..94 CDD:372399 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.