Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_693270.2 | Gene: | fbxl3l / 564855 | ZFINID: | ZDB-GENE-130530-598 | Length: | 448 | Species: | Danio rerio |
Alignment Length: | 250 | Identity: | 50/250 - (20%) |
---|---|---|---|
Similarity: | 81/250 - (32%) | Gaps: | 87/250 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 DELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLS------------------ 170
Fly 171 -----------------------KCQWLTTGAVDALTLH--QSKLVEFDISYCGAIGERCLIIFF 210
Fly 211 RKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRR 275
Fly 276 CPRVTELSLAP------------------LRQRRLYIDRPQPDVGLNAYNLNDFY 312 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | |
AMN1 | 96..>261 | CDD:187754 | 37/179 (21%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 6/12 (50%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 11/67 (16%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 5/39 (13%) | ||
fbxl3l | XP_693270.2 | F-box-like | 56..99 | CDD:289689 | |
leucine-rich repeat | 194..218 | CDD:275381 | 6/11 (55%) | ||
leucine-rich repeat | 220..245 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 246..271 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 272..306 | CDD:275381 | 6/39 (15%) | ||
leucine-rich repeat | 307..353 | CDD:275381 | 13/52 (25%) | ||
AMN1 | <347..>412 | CDD:187754 | 15/74 (20%) | ||
leucine-rich repeat | 354..380 | CDD:275381 | 8/35 (23%) | ||
leucine-rich repeat | 381..403 | CDD:275381 | 2/21 (10%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |