DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and fbxl3l

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_693270.2 Gene:fbxl3l / 564855 ZFINID:ZDB-GENE-130530-598 Length:448 Species:Danio rerio


Alignment Length:250 Identity:50/250 - (20%)
Similarity:81/250 - (32%) Gaps:87/250 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLS------------------ 170
            |..|..|:|||...|..:.::.|.:::...:..:..:|..||.|.|:                  
Zfish   206 DPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDELLLALSSEKHV 270

  Fly   171 -----------------------KCQWLTTGAVDALTLH--QSKLVEFDISYCGAIGERCLIIFF 210
                                   |..|      |||..|  |..:|.:...|     |.....||
Zfish   271 HLEHLRIDVVSENPGQTQFHTIKKSSW------DALIRHSPQVNIVMYFFLY-----EEEFEPFF 324

  Fly   211 RKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRR 275
            |:...:|.|....  :|:..:|.:||..|..|  :.::.||    .|:..|....:|:..    |
Zfish   325 REETPVTHLYFGR--AVSKDMLGRIGLNCPRL--VELVVCA----NGLEPLDEELIRIAD----R 377

  Fly   276 CPRVTELSLAP------------------LRQRRLYIDRPQPDVGLNAYNLNDFY 312
            |..:|.:.|..                  |.|..:..:...||   |.||:...:
Zfish   378 CKSLTAIGLGECEVTCSGFMEFVKMCGGRLSQLSIMEEVLIPD---NTYNIEQIH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381
AMN1 96..>261 CDD:187754 37/179 (21%)
leucine-rich repeat 111..137 CDD:275381 6/12 (50%)
leucine-rich repeat 138..163 CDD:275381 3/24 (13%)
leucine-rich repeat 164..189 CDD:275381 11/67 (16%)
leucine-rich repeat 190..215 CDD:275381 6/24 (25%)
leucine-rich repeat 216..241 CDD:275381 7/24 (29%)
leucine-rich repeat 242..267 CDD:275381 5/24 (21%)
leucine-rich repeat 268..290 CDD:275381 5/39 (13%)
fbxl3lXP_693270.2 F-box-like 56..99 CDD:289689
leucine-rich repeat 194..218 CDD:275381 6/11 (55%)
leucine-rich repeat 220..245 CDD:275381 3/24 (13%)
leucine-rich repeat 246..271 CDD:275381 4/24 (17%)
leucine-rich repeat 272..306 CDD:275381 6/39 (15%)
leucine-rich repeat 307..353 CDD:275381 13/52 (25%)
AMN1 <347..>412 CDD:187754 15/74 (20%)
leucine-rich repeat 354..380 CDD:275381 8/35 (23%)
leucine-rich repeat 381..403 CDD:275381 2/21 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.