DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and Lrrc29

DIOPT Version :10

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006255593.1 Gene:Lrrc29 / 502201 RGDID:1593150 Length:673 Species:Rattus norvegicus


Alignment Length:289 Identity:71/289 - (24%)
Similarity:112/289 - (38%) Gaps:79/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YLSLKDLFNLRCCSRTAQRFVEAALEKRQELHLSGNNTKNIDVAFRVLARCC------------- 108
            :||||.|          ||..:|.......||    ..:::|     :|.||             
  Rat   360 HLSLKKL----------QRLTDAGCIALGALH----ELQSLD-----MAECCLVSGRELAQVLGS 405

  Fly   109 -----QRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLK 168
                 ..|..|.||.|..|.|..:|.::......|..::|:.||.:|..::|.|......|.||:
  Rat   406 VRRAPPALTSLRLAYCSSLKDASVLSMIPALGPSLKVLDLSSCVALTNQTMQAICTYLIHLSVLR 470

  Fly   169 LSKCQWLTTGAVDAL-----------TLHQ------------------------SKLVEFDISYC 198
            |:.|:.|....:..|           .|||                        ..|.|.|::.|
  Rat   471 LAWCKELQDWGLLGLKEPSDEPVLNPQLHQEVENQAPDHQEPSSEPQGSSLLMLQALQELDLTAC 535

  Fly   199 GAIGERCL--IIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYG-VHA 260
            ..:.:..|  ::.|.:|.:   |||:..|:.||..|:.:...|..||.:.:..|:.:||.| |.|
  Rat   536 SKLTDASLAKVLQFPQLRQ---LSLSLLPAFTDMGLVAVARGCPSLERLTLSHCSHLSDEGWVQA 597

  Fly   261 LTVHCLRLRTLLIRRCPRVTELSLAPLRQ 289
            ..: ..||:.|.:..|.:|||.:|..:.|
  Rat   598 ARL-WPRLQHLNLSSCSQVTEQTLDTIGQ 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 F-box_FBXL15 41..84 CDD:438898 8/26 (31%)
leucine-rich repeat 85..110 CDD:275381 6/42 (14%)
AMN1 96..>261 CDD:187754 51/220 (23%)
leucine-rich repeat 111..137 CDD:275381 8/25 (32%)
leucine-rich repeat 138..163 CDD:275381 7/24 (29%)
leucine-rich repeat 164..189 CDD:275381 10/59 (17%)
leucine-rich repeat 190..215 CDD:275381 7/26 (27%)
leucine-rich repeat 216..241 CDD:275381 8/24 (33%)
leucine-rich repeat 242..267 CDD:275381 8/25 (32%)
leucine-rich repeat 268..290 CDD:275381 8/22 (36%)
Lrrc29XP_006255593.1 leucine-rich repeat 124..142 CDD:275381
PPP1R42 <170..410 CDD:455733 14/68 (21%)
leucine-rich repeat 173..206 CDD:275381
leucine-rich repeat 207..232 CDD:275381
leucine-rich repeat 233..279 CDD:275381
leucine-rich repeat 280..300 CDD:275381
AMN1 292..480 CDD:187754 35/138 (25%)
leucine-rich repeat 306..331 CDD:275381
leucine-rich repeat 332..357 CDD:275381
leucine-rich repeat 358..439 CDD:275381 22/97 (23%)
leucine-rich repeat 383..408 CDD:275381 4/29 (14%)
leucine-rich repeat 413..437 CDD:275381 8/23 (35%)
leucine-rich repeat 440..465 CDD:275381 7/24 (29%)
leucine-rich repeat 466..526 CDD:275381 10/59 (17%)
leucine-rich repeat 527..577 CDD:275381 15/52 (29%)
AMN1 <564..>638 CDD:187754 21/63 (33%)
leucine-rich repeat 578..603 CDD:275381 8/25 (32%)
leucine-rich repeat 604..629 CDD:275381 8/22 (36%)
leucine-rich repeat 630..655 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.