Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038942467.1 | Gene: | Fbxl16 / 494223 | RGDID: | 1309127 | Length: | 488 | Species: | Rattus norvegicus |
Alignment Length: | 254 | Identity: | 63/254 - (24%) |
---|---|---|---|
Similarity: | 94/254 - (37%) | Gaps: | 50/254 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 VEAALEKRQ---ELHLSGNN--------------------TKNIDVAFRVLARCCQ--------R 110
Fly 111 LEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWL 175
Fly 176 TTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLSLAN-----TPS----VTDQV 231
Fly 232 LIQIGNYCRELEHINVIGCAAISDYGV-HALTVHCLRLRTLLIRRCPRVTELSLAPLRQ 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 11/55 (20%) |
AMN1 | 96..>261 | CDD:187754 | 43/182 (24%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 6/25 (24%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 8/33 (24%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 6/25 (24%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 8/22 (36%) | ||
Fbxl16 | XP_038942467.1 | leucine-rich repeat | 195..219 | CDD:275381 | 3/8 (38%) |
AMN1 | 201..422 | CDD:187754 | 49/218 (22%) | ||
leucine-rich repeat | 220..243 | CDD:275381 | 5/22 (23%) | ||
leucine-rich repeat | 244..269 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 270..321 | CDD:275381 | 10/56 (18%) | ||
leucine-rich repeat | 322..347 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 348..373 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 374..407 | CDD:275381 | 8/33 (24%) | ||
leucine-rich repeat | 408..427 | CDD:275381 | 4/18 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR13318 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |