DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and Fbxl16

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_038942467.1 Gene:Fbxl16 / 494223 RGDID:1309127 Length:488 Species:Rattus norvegicus


Alignment Length:254 Identity:63/254 - (24%)
Similarity:94/254 - (37%) Gaps:50/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VEAALEKRQ---ELHLSGNN--------------------TKNIDVAFRVLARCCQ--------R 110
            :|..||:.|   .|.|||.|                    :..|:||...:|...|        .
  Rat   210 LEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELS 274

  Fly   111 LEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWL 175
            |:..|      :||..|....|........:.|..|..||...:..::.....|..|.||.|..:
  Rat   275 LQAYH------VTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTSLSLSGCSKV 333

  Fly   176 TTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLSLAN-----TPS----VTDQV 231
            |...|:.:..:..||...|:|:|..|.:..|......|::|..|.|..     ||.    :||..
  Rat   334 TDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCTHPYTPGWCVRITDTG 398

  Fly   232 LIQIGNYCRELEHINVIGCAAISDYGV-HALTVHCLRLRTLLIRRCPRVTELSLAPLRQ 289
            |..:.. ...|..:.:..|..:.|:|: |.|.:..|||  |.:..||.:|...|:.|.|
  Rat   399 LSYLST-MSSLRSLYLRWCCQVQDFGLKHLLAMRSLRL--LSLAGCPLLTTTGLSGLVQ 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 11/55 (20%)
AMN1 96..>261 CDD:187754 43/182 (24%)
leucine-rich repeat 111..137 CDD:275381 6/25 (24%)
leucine-rich repeat 138..163 CDD:275381 4/24 (17%)
leucine-rich repeat 164..189 CDD:275381 7/24 (29%)
leucine-rich repeat 190..215 CDD:275381 7/24 (29%)
leucine-rich repeat 216..241 CDD:275381 8/33 (24%)
leucine-rich repeat 242..267 CDD:275381 6/25 (24%)
leucine-rich repeat 268..290 CDD:275381 8/22 (36%)
Fbxl16XP_038942467.1 leucine-rich repeat 195..219 CDD:275381 3/8 (38%)
AMN1 201..422 CDD:187754 49/218 (22%)
leucine-rich repeat 220..243 CDD:275381 5/22 (23%)
leucine-rich repeat 244..269 CDD:275381 5/24 (21%)
leucine-rich repeat 270..321 CDD:275381 10/56 (18%)
leucine-rich repeat 322..347 CDD:275381 7/24 (29%)
leucine-rich repeat 348..373 CDD:275381 7/24 (29%)
leucine-rich repeat 374..407 CDD:275381 8/33 (24%)
leucine-rich repeat 408..427 CDD:275381 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.