DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and fbxl4

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001007316.1 Gene:fbxl4 / 492349 ZFINID:ZDB-GENE-041114-187 Length:607 Species:Danio rerio


Alignment Length:377 Identity:87/377 - (23%)
Similarity:132/377 - (35%) Gaps:116/377 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLHPEEEAHLMAMAS-----------------GGQPTRTASPR-----PLV--------TASIAA 37
            |.||.....:||.:.                 .|:|.:..:|:     |.:        ...:..
Zfish   134 TYHPGAIVKIMACSLNPFSQNPPTDVRWEVLWSGKPNKALTPQARQFSPNIKQISFTTNLLRLEV 198

  Fly    38 PRSLFDVCWD-DVLI-------PQVAVY----LSLKDLFNLR---------CCSRTAQRFVEAAL 81
            ..||.|...: |.:|       |.:|:|    :.:.||.:..         ||..||        
Zfish   199 NSSLLDYYTELDAVILRGVRERPILALYKIPVIDINDLSDSEEEISEAGGLCCRSTA-------- 255

  Fly    82 EKRQEL------------------HLSGNNTKNIDVAFRVLARCCQRLEVLHLACC--------- 119
            |.||.|                  ||...:          |.|..|..::.|..||         
Zfish   256 ENRQSLANGYFDRLPYELIQLIVSHLPVPD----------LCRLAQSCKLFHKHCCDPLQYIQLS 310

  Fly   120 ---RW--LTDELLLPLLANNKKRLWAVNLNECVN---ITALSLQPIIVEC-KELRVLKLSKCQWL 175
               .|  |||..|.. |.:....|..:||:...|   :|.......:..| ..|..|::|.|.:|
Zfish   311 LQPYWARLTDASLCH-LQSRCTLLQRLNLSWTGNRGAVTPAGFCSFMKACGASLVCLEVSCCHFL 374

  Fly   176 TTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLS---LANTPSVTDQVLIQIGN 237
            |...::.:|.....|.|.:::.|..:..:.    |..:.|||.|.   |..| .|....::.|..
Zfish   375 TEACLEVITQTCPCLQELNLASCDRLQPQA----FNHIAKLTHLRRLVLYRT-KVEQSAILSILT 434

  Fly   238 YCRELEHINVIGCAAISDYG--VHALTVHCLRLRTLLIRRCPRVTELSLAPL 287
            :|.||.|:|:..|..|.||.  |..|:..|..||:|.:.||..::|..||.|
Zfish   435 FCPELRHLNLGSCVMIEDYDVVVSMLSARCRSLRSLDLWRCRNLSERGLAEL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 6/42 (14%)
AMN1 96..>261 CDD:187754 47/187 (25%)
leucine-rich repeat 111..137 CDD:275381 9/39 (23%)
leucine-rich repeat 138..163 CDD:275381 6/28 (21%)
leucine-rich repeat 164..189 CDD:275381 7/24 (29%)
leucine-rich repeat 190..215 CDD:275381 4/24 (17%)
leucine-rich repeat 216..241 CDD:275381 8/27 (30%)
leucine-rich repeat 242..267 CDD:275381 10/26 (38%)
leucine-rich repeat 268..290 CDD:275381 9/20 (45%)
fbxl4NP_001007316.1 F-box-like 266..312 CDD:289689 8/55 (15%)
leucine-rich repeat 281..303 CDD:275381 7/31 (23%)
leucine-rich repeat 304..326 CDD:275381 5/22 (23%)
AMN1 <317..436 CDD:187754 30/124 (24%)
leucine-rich repeat 333..362 CDD:275381 6/28 (21%)
leucine-rich repeat 363..388 CDD:275381 7/24 (29%)
leucine-rich repeat 389..413 CDD:275381 6/27 (22%)
AMN1 414..591 CDD:187754 26/74 (35%)
leucine-rich repeat 414..438 CDD:275381 6/24 (25%)
leucine-rich repeat 439..466 CDD:275381 10/26 (38%)
leucine-rich repeat 467..492 CDD:275381 9/20 (45%)
leucine-rich repeat 493..520 CDD:275381
leucine-rich repeat 521..545 CDD:275381
leucine-rich repeat 547..572 CDD:275381
leucine-rich repeat 573..598 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.