DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and FipoQ

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster


Alignment Length:284 Identity:70/284 - (24%)
Similarity:104/284 - (36%) Gaps:95/284 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DDVLIPQVAVYLSLKDLFNL-RCCSRTAQRFVEAALEKRQEL--HLSGNNTKNIDVAFRVLARCC 108
            |.||: .:..|||.:::..| |.|.|..|...:..|.|...|  .:||                 
  Fly    39 DKVLL-HIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSG----------------- 85

  Fly   109 QRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQ 173
                 ||:...     |:||.|:        :|.....:....|.::  ::....|..|. :||.
  Fly    86 -----LHVGSL-----EMLLQLI--------SVRFGPTLRYIELPIE--LITHTVLHELS-AKCP 129

  Fly   174 WLTTGAVD---ALTLHQ-SKLVEF--DISY-CGAIGERCLII----FFRK----LNKLTVLSLAN 223
            .||...:|   |:.||. |::..|  .:.| |..:.|   :|    |.||    :|.|.||.|  
  Fly   130 NLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCVCLSE---VIFMEGFMRKIYNFINGLEVLHL-- 189

  Fly   224 TPSVTDQVLIQIGNY--CRELEH--------------------INVIGCAAISDYGVHALTVHCL 266
                       ||.|  |.|.|.                    ||:.|...|.|..:.|.:.:|:
  Fly   190 -----------IGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCI 243

  Fly   267 RLRTLLIRRCPRVTELSLAPLRQR 290
            :|..|.:..|.:||..:|..|.||
  Fly   244 QLECLAVNFCNKVTGSTLKTLIQR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 3/26 (12%)
AMN1 96..>261 CDD:187754 43/201 (21%)
leucine-rich repeat 111..137 CDD:275381 6/25 (24%)
leucine-rich repeat 138..163 CDD:275381 2/24 (8%)
leucine-rich repeat 164..189 CDD:275381 10/28 (36%)
leucine-rich repeat 190..215 CDD:275381 8/35 (23%)
leucine-rich repeat 216..241 CDD:275381 8/26 (31%)
leucine-rich repeat 242..267 CDD:275381 8/44 (18%)
leucine-rich repeat 268..290 CDD:275381 7/21 (33%)
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 13/41 (32%)
leucine-rich repeat 131..156 CDD:275381 8/24 (33%)
leucine-rich repeat 157..175 CDD:275381 5/20 (25%)
leucine-rich repeat 219..244 CDD:275381 7/24 (29%)
leucine-rich repeat 245..270 CDD:275381 9/23 (39%)
leucine-rich repeat 271..295 CDD:275381
leucine-rich repeat 296..320 CDD:275381
leucine-rich repeat 321..348 CDD:275381
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457948
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.