DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and FipoQ

DIOPT Version :10

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster


Alignment Length:284 Identity:71/284 - (25%)
Similarity:104/284 - (36%) Gaps:95/284 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DDVLIPQVAVYLSLKDLFNL-RCCSRTAQRFVEAALEKRQELHLSGNNTKNIDVAFRVLARCCQR 110
            |.||: .:..|||.:::..| |.|.|..|...:..|.|...|                      |
  Fly    39 DKVLL-HIFSYLSHREICRLARICRRWRQIAYDTRLWKNVS
L----------------------R 80

  Fly   111 LEV--LHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQ 173
            .||  ||:...     |:||.|:        :|.....:....|.::  ::....|..|. :||.
  Fly    81 PEVSGLHVGSL-----EMLLQLI--------SVRFGPTLRYIELPIE--LITHTVLHELS-AKCP 129

  Fly   174 WLTTGAVD---ALTLHQ-SKLVEF--DISY-CGAIGERCLII----FFRK----LNKLTVLSLAN 223
            .||...:|   |:.||. |::..|  .:.| |..:.|   :|    |.||    :|.|.||.|  
  Fly   130 NLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCVCLSE---VIFMEGFMRKIYNFINGLEVLHL-- 189

  Fly   224 TPSVTDQVLIQIGNY--CRELEH--------------------INVIGCAAISDYGVHALTVHCL 266
                       ||.|  |.|.|.                    ||:.|...|.|..:.|.:.:|:
  Fly   190 -----------IGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCI 243

  Fly   267 RLRTLLIRRCPRVTELSLAPLRQR 290
            :|..|.:..|.:||..:|..|.||
  Fly   244 QLECLAVNFCNKVTGSTLKTLIQR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 F-box_FBXL15 41..84 CDD:438898 12/37 (32%)
leucine-rich repeat 85..110 CDD:275381 1/24 (4%)
AMN1 96..>261 CDD:187754 46/203 (23%)
leucine-rich repeat 111..137 CDD:275381 8/27 (30%)
leucine-rich repeat 138..163 CDD:275381 2/24 (8%)
leucine-rich repeat 164..189 CDD:275381 10/28 (36%)
leucine-rich repeat 190..215 CDD:275381 8/35 (23%)
leucine-rich repeat 216..241 CDD:275381 8/26 (31%)
leucine-rich repeat 242..267 CDD:275381 8/44 (18%)
leucine-rich repeat 268..290 CDD:275381 7/21 (33%)
FipoQNP_733291.1 F-box-like 34..78 CDD:463757 13/39 (33%)
ING 110..>166 CDD:355795 15/58 (26%)
leucine-rich repeat 131..156 CDD:275381 8/24 (33%)
leucine-rich repeat 157..175 CDD:275381 5/20 (25%)
leucine-rich repeat 219..244 CDD:275381 7/24 (29%)
leucine-rich repeat 245..270 CDD:275381 9/23 (39%)
leucine-rich repeat 271..295 CDD:275381
leucine-rich repeat 296..320 CDD:275381
leucine-rich repeat 321..348 CDD:275381
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.