Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
Alignment Length: | 215 | Identity: | 59/215 - (27%) |
---|---|---|---|
Similarity: | 100/215 - (46%) | Gaps: | 21/215 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 LHLSG---NNTKNIDVAF--RVLARCCQ-------RLEVLHLACCRWLTDELLLPLLANN-KKRL 138
Fly 139 WAVNLNECVNITALSLQPIIVECKELRVLKLSKC-QWLTTGAVDALTLHQSKLVEFDISYCGAIG 202
Fly 203 ERCLIIF------FRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHAL 261
Fly 262 TVHCLRLRTLLIRRCPRVTE 281 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 7/34 (21%) |
AMN1 | 96..>261 | CDD:187754 | 48/181 (27%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 12/26 (46%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 8/25 (32%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 4/14 (29%) | ||
CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
leucine-rich repeat | 281..303 | CDD:275381 | |||
LRR_RI | <297..482 | CDD:238064 | 37/133 (28%) | ||
leucine-rich repeat | 304..330 | CDD:275381 | |||
leucine-rich repeat | 331..357 | CDD:275381 | 2/8 (25%) | ||
leucine-rich repeat | 358..379 | CDD:275381 | 5/20 (25%) | ||
leucine-rich repeat | 384..409 | CDD:275381 | 12/24 (50%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 4/24 (17%) | ||
AMN1 | 430..595 | CDD:187754 | 35/133 (26%) | ||
leucine-rich repeat | 438..464 | CDD:275381 | 8/25 (32%) | ||
leucine-rich repeat | 465..496 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 497..521 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 522..547 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 548..573 | CDD:275381 | 4/14 (29%) | ||
leucine-rich repeat | 574..599 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45457958 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |