Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
Alignment Length: | 236 | Identity: | 55/236 - (23%) |
---|---|---|---|
Similarity: | 92/236 - (38%) | Gaps: | 51/236 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 VC--WDDVLIPQVAVYLSLKDLF-NLRCCSRTAQRFVEAALEKRQELHLSGNNT----------- 94
Fly 95 ------KNIDV------AFRVLARC-CQRLEVLHLACCRWLTDELL----------LPLLANNKK 136
Fly 137 RLWAVNLNEC--VNITALSLQPIIVECKELRVLKLSKCQWLTTGAVDAL---TLHQSKLVEFDIS 196
Fly 197 YCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGN 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 10/48 (21%) |
AMN1 | 96..>261 | CDD:187754 | 42/164 (26%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 9/35 (26%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 3/26 (12%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 10/27 (37%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 7/22 (32%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | |||
leucine-rich repeat | 268..290 | CDD:275381 | |||
Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
PRTases_typeI | <394..>467 | CDD:294217 | |||
zf-CXXC | 670..716 | CDD:251032 | |||
PHD_4 | 721..801 | CDD:293471 | |||
F-box-like | <1073..1108 | CDD:289689 | 5/27 (19%) | ||
leucine-rich repeat | 1102..1125 | CDD:275381 | 3/22 (14%) | ||
leucine-rich repeat | 1126..1149 | CDD:275381 | 3/22 (14%) | ||
leucine-rich repeat | 1150..1173 | CDD:275381 | 6/22 (27%) | ||
AMN1 | 1166..>1320 | CDD:187754 | 40/150 (27%) | ||
leucine-rich repeat | 1174..1213 | CDD:275381 | 11/38 (29%) | ||
leucine-rich repeat | 1214..1238 | CDD:275381 | 2/23 (9%) | ||
leucine-rich repeat | 1239..1267 | CDD:275381 | 10/27 (37%) | ||
leucine-rich repeat | 1268..1292 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 1293..1317 | CDD:275381 | 7/22 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |