Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998107.1 | Gene: | fbxl15 / 405878 | ZFINID: | ZDB-GENE-040426-2440 | Length: | 296 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 76/272 - (27%) |
---|---|---|---|
Similarity: | 137/272 - (50%) | Gaps: | 26/272 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 LFDVCWDDVLIPQVAVYLSLKDLFNLRCCSRTAQRFVEAALEKRQELHLSGNNTKNID------- 98
Fly 99 ---VAFRVLARCCQRLEVLHLA---CCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPI 157
Fly 158 IVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLSLA 222
Fly 223 NTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRCPRVTELSLAPL 287
Fly 288 RQRRLYIDRPQP 299 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 5/34 (15%) |
AMN1 | 96..>261 | CDD:187754 | 46/177 (26%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 11/28 (39%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 10/21 (48%) | ||
fbxl15 | NP_998107.1 | F-box | 16..>52 | CDD:279040 | 12/35 (34%) |
leucine-rich repeat | 51..85 | CDD:275381 | 6/43 (14%) | ||
leucine-rich repeat | 86..112 | CDD:275381 | 11/28 (39%) | ||
AMN1 | <111..272 | CDD:187754 | 45/160 (28%) | ||
leucine-rich repeat | 113..138 | CDD:275381 | 6/24 (25%) | ||
LRR 1 | 138..159 | 6/20 (30%) | |||
leucine-rich repeat | 139..164 | CDD:275381 | 8/24 (33%) | ||
LRR 2 | 164..185 | 3/20 (15%) | |||
leucine-rich repeat | 165..190 | CDD:275381 | 4/24 (17%) | ||
LRR 3 | 190..211 | 6/20 (30%) | |||
leucine-rich repeat | 191..216 | CDD:275381 | 7/24 (29%) | ||
LRR 4 | 216..237 | 4/20 (20%) | |||
leucine-rich repeat | 217..242 | CDD:275381 | 5/24 (21%) | ||
LRR 5 | 242..263 | 8/20 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 105 | 1.000 | Domainoid score | I6564 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H44220 | |
Inparanoid | 1 | 1.050 | 122 | 1.000 | Inparanoid score | I4718 |
OMA | 1 | 1.010 | - | - | QHG50180 | |
OrthoDB | 1 | 1.010 | - | - | D1154571at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | oto41481 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_108979 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5025 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
12 | 11.770 |