DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and CG11044

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster


Alignment Length:294 Identity:64/294 - (21%)
Similarity:100/294 - (34%) Gaps:109/294 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LKDLFNLRCCSRTAQRFVEAALEKRQELHLSGNNTKNIDVAFRVLARCCQRLEVLHLA------C 118
            ||:|. ||.......:.|:..||:.:..||       :|   .|:..||.::.||:|.      |
  Fly   209 LKELL-LRLTDLHTLKLVDFVLERYEANHL-------LD---EVVCSCCTKMRVLNLVNVTTMHC 262

  Fly   119 ----------CRWLT------DELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVEC------ 161
                      .:.||      |:.:|.|||:.|.|...: |..|...:.|::....|:.      
  Fly   263 PIMHVGLFLNLQVLTISPQNIDDDVLSLLADTKLRHLHL-LQNCYTPSHLTISACGVKAWRNVKK 326

  Fly   162 --KELRV-LKLSKCQWLTTGAVDALTLHQSKLVEFDISYCG---AIGERCLI------------- 207
              ..||| |:|..   ||.|.|    :.|.:.....|:||.   .|....|:             
  Fly   327 TNPRLRVHLRLEN---LTDGEV----VLQPEAPVHSITYCAPQTRIRAELLVRMVDHYKSTLAVY 384

  Fly   208 ------------IFFRKLNKLTVL---------SLANTPSVTDQVLIQIGNYCRELEHINVIGCA 251
                        .|..:::.|.:|         :|.....|:...|:.|....:.|:|::|    
  Fly   385 GHELLPRFSSPKPFHSRIDSLMLLMCRQCFNVDTLIIREKVSTSTLLLIAKTAKNLQHLHV---- 445

  Fly   252 AISDYGVHALTVHCLRLRTLLIRRC--PRVTELS 283
                            .|..:|.||  ||..|.|
  Fly   446 ----------------RRFAVILRCDWPRHPEWS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 6/24 (25%)
AMN1 96..>261 CDD:187754 46/232 (20%)
leucine-rich repeat 111..137 CDD:275381 12/47 (26%)
leucine-rich repeat 138..163 CDD:275381 4/32 (13%)
leucine-rich repeat 164..189 CDD:275381 10/25 (40%)
leucine-rich repeat 190..215 CDD:275381 6/52 (12%)
leucine-rich repeat 216..241 CDD:275381 6/33 (18%)
leucine-rich repeat 242..267 CDD:275381 3/24 (13%)
leucine-rich repeat 268..290 CDD:275381 8/18 (44%)
CG11044NP_611456.1 F-box-like 51..94 CDD:289689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.