DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and Fbxl22

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001102239.1 Gene:Fbxl22 / 363083 RGDID:1311830 Length:236 Species:Rattus norvegicus


Alignment Length:151 Identity:37/151 - (24%)
Similarity:63/151 - (41%) Gaps:21/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RCCSRTAQRFVEAALEKRQELH----LSGNNTKNIDVAFRVLARC--CQRLEVLHL--------- 116
            |.||:....|.:..|......|    |..:|.: :..|.|.|:.|  ..|::|..:         
  Rat    28 RTCSQLRDVFEDPTLWSLLHFHSLTELKKDNFR-LSPALRSLSICWHSSRVQVCSIEDWLKSAFQ 91

  Fly   117 --ACCRW--LTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTT 177
              .|.:.  |.::.||. :.|....|.:|.|:.|.::|...|..:::.|..||.|:|..|..:|.
  Rat    92 RSICSQHENLVNDFLLQ-VCNRCPNLASVTLSGCGHVTDDCLARLLLGCPRLRALRLENCARVTN 155

  Fly   178 GAVDALTLHQSKLVEFDISYC 198
            ..:.|:..|...|..|.:.:|
  Rat   156 RTLAAVAAHGRALQTFHVDFC 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 7/30 (23%)
AMN1 96..>261 CDD:187754 29/118 (25%)
leucine-rich repeat 111..137 CDD:275381 6/38 (16%)
leucine-rich repeat 138..163 CDD:275381 7/24 (29%)
leucine-rich repeat 164..189 CDD:275381 8/24 (33%)
leucine-rich repeat 190..215 CDD:275381 3/9 (33%)
leucine-rich repeat 216..241 CDD:275381
leucine-rich repeat 242..267 CDD:275381
leucine-rich repeat 268..290 CDD:275381
Fbxl22NP_001102239.1 F-box-like 3..43 CDD:403981 4/14 (29%)
AMN1 44..>191 CDD:187754 32/135 (24%)
leucine-rich repeat 116..141 CDD:275381 7/24 (29%)
leucine-rich repeat 142..167 CDD:275381 8/24 (33%)
leucine-rich repeat 168..193 CDD:275381 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.