| Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001005563.1 | Gene: | Fbxl6 / 362941 | RGDID: | 1359687 | Length: | 535 | Species: | Rattus norvegicus |
| Alignment Length: | 377 | Identity: | 85/377 - (22%) |
|---|---|---|---|
| Similarity: | 135/377 - (35%) | Gaps: | 116/377 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 AMASGGQPTRTASPRPLVTASIAAPR---SL---FDVCWDDVLIPQVAVYLSLKDLFNLRCCSRT 72
Fly 73 AQRFVEAALEKRQELH-----------------LSGNNTK-NIDVAFRVLARC-----------C 108
Fly 109 QRLEVLHLACCRWLTD-ELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKC 172
Fly 173 QWLTTGAVDALTLHQSKLVEFDISY-------CGAIGERCLIIFFRKLNKLTV---LSLANTPSV 227
Fly 228 TDQVLIQIGNYCRELEHINVIG------------------------------CAAISDYGVHALT 262
Fly 263 VHCL-RLRTLLIRRCPRVTELSLAPL---RQRRLYIDRPQPDVGLNAYNLND 310 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 8/53 (15%) |
| AMN1 | 96..>261 | CDD:187754 | 43/216 (20%) | ||
| leucine-rich repeat | 111..137 | CDD:275381 | 5/26 (19%) | ||
| leucine-rich repeat | 138..163 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 164..189 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 190..215 | CDD:275381 | 5/31 (16%) | ||
| leucine-rich repeat | 216..241 | CDD:275381 | 9/27 (33%) | ||
| leucine-rich repeat | 242..267 | CDD:275381 | 6/55 (11%) | ||
| leucine-rich repeat | 268..290 | CDD:275381 | 9/24 (38%) | ||
| Fbxl6 | NP_001005563.1 | F-box-like | 105..155 | CDD:289689 | 8/54 (15%) |
| AMN1 | 171..390 | CDD:187754 | 51/231 (22%) | ||
| leucine-rich repeat | 188..213 | CDD:275381 | 7/29 (24%) | ||
| leucine-rich repeat | 214..239 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 240..291 | CDD:275381 | 11/54 (20%) | ||
| leucine-rich repeat | 292..321 | CDD:275381 | 10/30 (33%) | ||
| leucine-rich repeat | 322..349 | CDD:275381 | 1/26 (4%) | ||
| AMN1 | <349..500 | CDD:187754 | 19/76 (25%) | ||
| leucine-rich repeat | 350..377 | CDD:275381 | 5/27 (19%) | ||
| leucine-rich repeat | 378..401 | CDD:275381 | 9/22 (41%) | ||
| leucine-rich repeat | 434..466 | CDD:275381 | |||
| leucine-rich repeat | 467..491 | CDD:275381 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||