DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and Fbl6

DIOPT Version :10

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_610665.2 Gene:Fbl6 / 36201 FlyBaseID:FBgn0033609 Length:720 Species:Drosophila melanogaster


Alignment Length:273 Identity:64/273 - (23%)
Similarity:107/273 - (39%) Gaps:76/273 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IPQVAVYLS-------LKDLFNLRCCSRTAQRFVEAALEKRQELHLSGNNTKNIDVAFRVLARCC 108
            |||:...||       |.||.|:     |.|......      ||:            ..|.|.|
  Fly   466 IPQIVGILSTHCPNLTLLDLSNV-----TTQATSHGV------LHI------------EKLQRGC 507

  Fly   109 QRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNEC--VNITALS----------LQPIIVEC 161
            |:|:||.      :|:..:.|..|:.::.:.:....|.  :::.||:          ||.|:...
  Fly   508 QKLKVLR------VTNSHITPSTASMQEIMDSPGFPELEELSVAALTDESRIISDDHLQRILKSS 566

  Fly   162 KELRVLKLSKCQWLTTGAVDALTLHQS--KLVEFDISY-----CGA---IGERCLIIFFRKLNKL 216
            .:|::|.:..|..||         |:|  :|..:||.:     |..   :|....:|..:..:.|
  Fly   567 SKLKLLDVRNCTRLT---------HESLIRLPAWDIKHLFLSGCSVTRDMGSGLELIASKWAHSL 622

  Fly   217 TVLSL--ANTPSVTDQVLIQIGNYCRE--LEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRC- 276
            ..|.|  ||.....|..|..:....|:  |.|:|:.| :::||..|..:..:|..:.::.:..| 
  Fly   623 IELDLAWANMQQPIDNALRALAEKGRD
SPLAHLNLCG-SSVSDEAVKEILTNCQNMSSINLASCR 686

  Fly   277 --PR-VTELSLAP 286
              || |..|...|
  Fly   687 GLPRGVKRLMQGP 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 F-box_FBXL15 41..84 CDD:438898 11/39 (28%)
leucine-rich repeat 85..110 CDD:275381 5/24 (21%)
AMN1 96..>261 CDD:187754 44/190 (23%)
leucine-rich repeat 111..137 CDD:275381 6/25 (24%)
leucine-rich repeat 138..163 CDD:275381 6/36 (17%)
leucine-rich repeat 164..189 CDD:275381 7/26 (27%)
leucine-rich repeat 190..215 CDD:275381 6/32 (19%)
leucine-rich repeat 216..241 CDD:275381 7/26 (27%)
leucine-rich repeat 242..267 CDD:275381 8/24 (33%)
leucine-rich repeat 268..290 CDD:275381 6/23 (26%)
Fbl6NP_610665.2 PLN03237 <3..254 CDD:215641
F-box_FBXL6 291..336 CDD:438891
leucine-rich repeat 365..391 CDD:275381
LRR <366..>521 CDD:443914 21/83 (25%)
leucine-rich repeat 392..417 CDD:275381
leucine-rich repeat 418..445 CDD:275381
leucine-rich repeat 453..471 CDD:275381 3/4 (75%)
leucine-rich repeat 480..509 CDD:275381 11/51 (22%)
leucine-rich repeat 510..538 CDD:275381 6/33 (18%)
leucine-rich repeat 539..579 CDD:275381 8/39 (21%)
leucine-rich repeat 580..621 CDD:275381 10/49 (20%)
leucine-rich repeat 622..649 CDD:275381 7/26 (27%)
leucine-rich repeat 652..676 CDD:275381 8/24 (33%)
leucine-rich repeat 677..698 CDD:275381 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.