DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and Fbxl7

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001102015.1 Gene:Fbxl7 / 361907 RGDID:1305813 Length:491 Species:Rattus norvegicus


Alignment Length:369 Identity:86/369 - (23%)
Similarity:145/369 - (39%) Gaps:96/369 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MAMASGGQPTRTASPRPLVTASIAAPRSLFDVCWDDVLIPQVAVYLSLKDLFNLRC-CSRTAQRF 76
            :||.....|||...|...:.:.....::..|...|..:: |:..:|....|    | |:|..:|:
  Rat    85 VAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMV-QIFSFLPTNQL----CRCARVCRRW 144

  Fly    77 VEAALEKR--QELHLSGNNTKNIDVAFRVLAR--C------CQRLEVLHLACCRWLTDELLLPL- 130
            ...|.:.|  :.:.|:| .|.|:|.|.:||.|  |      |..||.:.::.||.|||..|..: 
  Rat   145 YNLAWDPRLWRTIRLTG-ETINVDRALKVLTRRLCQDTPNVCLMLETVIVSGCRRLTDRGLYTIA 208

  Fly   131 ---------------------------LANNKKRLWAVNLNECVNITALS--------------- 153
                                       |..|.:.|   :::.|..:|.:|               
  Rat   209 QCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHL---DVSGCSKVTCISLTREASIKLSPLHGK 270

  Fly   154 -------------------LQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCG 199
                               |..|...|.:|..|.|.:|..||...:..|.::.:.:.|..:|.|.
  Rat   271 QISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCR 335

  Fly   200 AIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVH 264
            .:.:..|....:..::|..||:|:...:||..:..:..||.:|.::|..||..|:|:||..|..:
  Rat   336 FVSDFGLREIAKLESRLRYLSIAHCGRITDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKN 400

  Fly   265 CLRLRTLLIRRCPRVTELSLAPLRQRRLYIDRPQPDVGLNAYNL 308
            |.:|::|.|.:||.|::..|..|              .||.:||
  Rat   401 CTKLKSLDIGKCPLVSDTGLESL--------------ALNCFNL 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 11/32 (34%)
AMN1 96..>261 CDD:187754 52/234 (22%)
leucine-rich repeat 111..137 CDD:275381 10/53 (19%)
leucine-rich repeat 138..163 CDD:275381 7/58 (12%)
leucine-rich repeat 164..189 CDD:275381 7/24 (29%)
leucine-rich repeat 190..215 CDD:275381 4/24 (17%)
leucine-rich repeat 216..241 CDD:275381 8/24 (33%)
leucine-rich repeat 242..267 CDD:275381 10/24 (42%)
leucine-rich repeat 268..290 CDD:275381 8/21 (38%)
Fbxl7NP_001102015.1 F-box-like 114..160 CDD:289689 11/50 (22%)
leucine-rich repeat 129..151 CDD:275381 7/25 (28%)
leucine-rich repeat 154..187 CDD:275381 11/33 (33%)
AMN1 <185..366 CDD:187754 34/183 (19%)
leucine-rich repeat 188..213 CDD:275381 8/24 (33%)
leucine-rich repeat 214..234 CDD:275381 0/19 (0%)
leucine-rich repeat 240..273 CDD:275381 4/35 (11%)
leucine-rich repeat 274..299 CDD:275381 3/24 (13%)
AMN1 297..464 CDD:187754 42/148 (28%)
leucine-rich repeat 300..325 CDD:275381 7/24 (29%)
leucine-rich repeat 326..351 CDD:275381 4/24 (17%)
leucine-rich repeat 352..377 CDD:275381 8/24 (33%)
leucine-rich repeat 378..403 CDD:275381 10/24 (42%)
leucine-rich repeat 404..429 CDD:275381 10/38 (26%)
leucine-rich repeat 430..453 CDD:275381 1/1 (100%)
leucine-rich repeat 456..480 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.