| Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_741248.1 | Gene: | fbxl-1 / 3564805 | WormBaseID: | WBGene00015350 | Length: | 466 | Species: | Caenorhabditis elegans |
| Alignment Length: | 259 | Identity: | 68/259 - (26%) |
|---|---|---|---|
| Similarity: | 113/259 - (43%) | Gaps: | 30/259 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 LKDLFNLRCCSRTAQRFVEAALEKRQEL-HLSGNNTKNI-DVAFRVLARCCQRLEVLHLACCRWL 122
Fly 123 TDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWLT----------T 177
Fly 178 GAVDALTLHQS-KLVEFDI---------------SYCGAIGERCLIIFFRKLNKLTVLSLANTPS 226
Fly 227 VTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRCPRVTELSLAPLRQR 290 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 9/26 (35%) |
| AMN1 | 96..>261 | CDD:187754 | 49/191 (26%) | ||
| leucine-rich repeat | 111..137 | CDD:275381 | 6/25 (24%) | ||
| leucine-rich repeat | 138..163 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 164..189 | CDD:275381 | 11/35 (31%) | ||
| leucine-rich repeat | 190..215 | CDD:275381 | 6/39 (15%) | ||
| leucine-rich repeat | 216..241 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 242..267 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 268..290 | CDD:275381 | 7/21 (33%) | ||
| fbxl-1 | NP_741248.1 | F-box-like | 60..101 | CDD:372399 | |
| AMN1 | <121..268 | CDD:187754 | 40/144 (28%) | ||
| leucine-rich repeat | 125..150 | CDD:275381 | 5/25 (20%) | ||
| leucine-rich repeat | 151..176 | CDD:275381 | 9/24 (38%) | ||
| leucine-rich repeat | 177..202 | CDD:275381 | 6/25 (24%) | ||
| leucine-rich repeat | 203..228 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 229..280 | CDD:275381 | 12/50 (24%) | ||
| AMN1 | <281..440 | CDD:187754 | 28/101 (28%) | ||
| leucine-rich repeat | 281..306 | CDD:275381 | 5/24 (21%) | ||
| leucine-rich repeat | 307..332 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 333..357 | CDD:275381 | 7/23 (30%) | ||
| leucine-rich repeat | 359..384 | CDD:275381 | 7/23 (30%) | ||
| leucine-rich repeat | 386..409 | CDD:275381 | |||
| leucine-rich repeat | 411..436 | CDD:275381 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||