Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_958890.1 | Gene: | fbxl14a / 333988 | ZFINID: | ZDB-GENE-030131-5920 | Length: | 411 | Species: | Danio rerio |
Alignment Length: | 251 | Identity: | 61/251 - (24%) |
---|---|---|---|
Similarity: | 115/251 - (45%) | Gaps: | 12/251 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 DVLIPQVAVYLSLKDLFNLRCCS---RTAQRFVEAALEKRQELHL-SGNNTKNIDVAF-----RV 103
Fly 104 LARCCQRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLK 168
Fly 169 LSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLI 233
Fly 234 QIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRCPRVTELSLAPLRQ 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 6/30 (20%) |
AMN1 | 96..>261 | CDD:187754 | 42/169 (25%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 10/25 (40%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 5/22 (23%) | ||
fbxl14a | NP_958890.1 | F-box-like | 5..46 | CDD:289689 | |
AMN1 | 90..243 | CDD:187754 | 31/111 (28%) | ||
leucine-rich repeat | 92..118 | CDD:275381 | |||
leucine-rich repeat | 119..144 | CDD:275381 | 4/11 (36%) | ||
leucine-rich repeat | 145..170 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 171..203 | CDD:275381 | 6/31 (19%) | ||
leucine-rich repeat | 204..229 | CDD:275381 | 10/25 (40%) | ||
AMN1 | 230..397 | CDD:187754 | 35/152 (23%) | ||
leucine-rich repeat | 230..254 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 255..280 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 281..304 | CDD:275381 | 6/22 (27%) | ||
leucine-rich repeat | 307..331 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 332..357 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 358..377 | CDD:275381 | 4/18 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |