DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and Fbxl12

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001273458.1 Gene:Fbxl12 / 30843 MGIID:1354738 Length:349 Species:Mus musculus


Alignment Length:226 Identity:50/226 - (22%)
Similarity:76/226 - (33%) Gaps:81/226 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 RCCQRLEVLHLACCRWLTDELLLPLLANNKKRLWAV----------------------------- 141
            |.|.|.:  .|...|||...:.|.|.....|.:|.:                             
Mouse    52 RVCHRWK--RLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASRLYSLRMGGYLFSGSQAPQLSP 114

  Fly   142 -----------NLNE-CVNITALSLQPIIVECKELRVLKLSKCQ----WLTTGAVDALTLHQSKL 190
                       ||.. |:::..||:.||......||.|:|..|:    ||.. ..|...|   .|
Mouse   115 ALMRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMIWLQK-EQDPTVL---PL 175

  Fly   191 VEFDISYCGAIGERCLII----FFR--------KLNKLTVLSLANTPSVTDQVL---IQIGNYCR 240
            :|            |:::    .||        :...|..|.|..|..||:..|   :|..:|.:
Mouse   176 LE------------CIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDASLQELSYLQ 228

  Fly   241 ELEHINVIGCAAISDYGVHALTVHCLRLRTL 271
            .||   |:||...:|..:.|::.|...:|.:
Mouse   229 RLE---VLGCTLSADSTLLAISRHLRDVRKI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 2/3 (67%)
AMN1 96..>261 CDD:187754 47/214 (22%)
leucine-rich repeat 111..137 CDD:275381 6/25 (24%)
leucine-rich repeat 138..163 CDD:275381 8/65 (12%)
leucine-rich repeat 164..189 CDD:275381 9/28 (32%)
leucine-rich repeat 190..215 CDD:275381 5/36 (14%)
leucine-rich repeat 216..241 CDD:275381 9/27 (33%)
leucine-rich repeat 242..267 CDD:275381 8/24 (33%)
leucine-rich repeat 268..290 CDD:275381 1/4 (25%)
Fbxl12NP_001273458.1 F-box-like <51..73 CDD:289689 7/22 (32%)
leucine-rich repeat 127..148 CDD:275381 6/20 (30%)
AMN1 144..>249 CDD:187754 30/123 (24%)
leucine-rich repeat 149..175 CDD:275381 9/29 (31%)
leucine-rich repeat 176..200 CDD:275381 4/35 (11%)
leucine-rich repeat 201..226 CDD:275381 8/24 (33%)
leucine-rich repeat 227..252 CDD:275381 8/27 (30%)
leucine-rich repeat 253..276 CDD:275381 1/4 (25%)
leucine-rich repeat 277..306 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.