Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011246510.1 | Gene: | Kdm2b / 30841 | MGIID: | 1354737 | Length: | 1312 | Species: | Mus musculus |
Alignment Length: | 215 | Identity: | 53/215 - (24%) |
---|---|---|---|
Similarity: | 76/215 - (35%) | Gaps: | 70/215 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 RWLTDELLLPLLANNKKRLWA-VNLNECVNITALSL------QPIIVECK--------------- 162
Fly 163 --ELRVLKLSKCQWLTTGAVDALTLHQSKLVE-FDISYC--------------------GAIGER 204
Fly 205 CLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLR 269
Fly 270 TLL----IRRCPRVTELSLA 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | |
AMN1 | 96..>261 | CDD:187754 | 44/185 (24%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 3/16 (19%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 11/48 (23%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 11/24 (46%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 6/45 (13%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 7/22 (32%) | ||
Kdm2b | XP_011246510.1 | JmjC | 151..226 | CDD:214721 | |
cupin_like | 198..297 | CDD:389752 | |||
JHD | 303..>338 | CDD:375347 | |||
zf-CXXC | <588..624 | CDD:366873 | |||
PHD_KDM2B | 634..695 | CDD:277114 | |||
PTZ00449 | <693..995 | CDD:185628 | |||
F-box-like | 1044..1082 | CDD:372399 | 7/22 (32%) | ||
leucine-rich repeat | 1053..1075 | CDD:275381 | 3/15 (20%) | ||
leucine-rich repeat | 1078..1102 | CDD:275381 | 8/23 (35%) | ||
AMN1 | 1083..1283 | CDD:187754 | 46/191 (24%) | ||
leucine-rich repeat | 1103..1126 | CDD:275381 | 0/22 (0%) | ||
leucine-rich repeat | 1127..1150 | CDD:275381 | 11/25 (44%) | ||
leucine-rich repeat | 1151..1190 | CDD:275381 | 5/44 (11%) | ||
leucine-rich repeat | 1191..1215 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 1216..1245 | CDD:275381 | 7/28 (25%) | ||
leucine-rich repeat | 1246..1270 | CDD:275381 | 6/18 (33%) | ||
leucine-rich repeat | 1271..1295 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |