Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038951543.1 | Gene: | Fbxl21 / 306750 | RGDID: | 1305555 | Length: | 460 | Species: | Rattus norvegicus |
Alignment Length: | 227 | Identity: | 56/227 - (24%) |
---|---|---|---|
Similarity: | 83/227 - (36%) | Gaps: | 77/227 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 CQRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKC 172
Fly 173 QWLTTGAVDALTLHQSKL----------VEFDISY-------------------CGAIGERCLII 208
Fly 209 FFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINV----IGCAAISDYGVHALTVHCLRLR 269
Fly 270 TLLIRRC-PRVTELSLAPLRQRRLYIDRPQPD 300 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 1/1 (100%) |
AMN1 | 96..>261 | CDD:187754 | 45/185 (24%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 10/25 (40%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 8/53 (15%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 3/28 (11%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 7/22 (32%) | ||
Fbxl21 | XP_038951543.1 | F-box-like | 68..111 | CDD:403981 | |
leucine-rich repeat | 206..231 | CDD:275381 | |||
leucine-rich repeat | 232..257 | CDD:275381 | 1/1 (100%) | ||
leucine-rich repeat | 258..283 | CDD:275381 | 10/30 (33%) | ||
leucine-rich repeat | 284..318 | CDD:275381 | 11/45 (24%) | ||
leucine-rich repeat | 329..365 | CDD:275381 | 7/40 (18%) | ||
AMN1 | <359..>424 | CDD:187754 | 21/87 (24%) | ||
leucine-rich repeat | 366..392 | CDD:275381 | 10/27 (37%) | ||
leucine-rich repeat | 393..418 | CDD:275381 | 5/40 (13%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |