DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and Fbxl21

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_038951543.1 Gene:Fbxl21 / 306750 RGDID:1305555 Length:460 Species:Rattus norvegicus


Alignment Length:227 Identity:56/227 - (24%)
Similarity:83/227 - (36%) Gaps:77/227 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 CQRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKC 172
            ||.|..|.|. ...|:|||||.|.:...     ||| |.:.|..:|..|     .:::...:.|.
  Rat   255 CQGLRELALN-YYILSDELLLALSSETH-----VNL-EHLRIDVVSENP-----GQIKFHSIKKP 307

  Fly   173 QWLTTGAVDALTLHQSKL----------VEFDISY-------------------CGAIGERCLII 208
            .|      |||..|...:          .|||..:                   .|.||..|   
  Rat   308 SW------DALVKHSPGVNVVMYFFLYEEEFDTFFKEETPVTHLYFGRSVSRTILGRIGLNC--- 363

  Fly   209 FFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINV----IGCAAISDYGVHALTVHCLRLR 269
              .:|.:|.|  .||.....|..||:|..:|:.|..:.:    :.|:|..::             
  Rat   364 --PRLIELVV--CANGLQPLDSELIRIAEHCKNLTALGLSECEVSCSAFVEF------------- 411

  Fly   270 TLLIRRC-PRVTELSLAPLRQRRLYIDRPQPD 300
               :|.| .|:|:|||  :.:..:..||..||
  Rat   412 ---VRLCGRRLTQLSL--MEEVLVPDDRYTPD 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 1/1 (100%)
AMN1 96..>261 CDD:187754 45/185 (24%)
leucine-rich repeat 111..137 CDD:275381 10/25 (40%)
leucine-rich repeat 138..163 CDD:275381 7/24 (29%)
leucine-rich repeat 164..189 CDD:275381 6/24 (25%)
leucine-rich repeat 190..215 CDD:275381 8/53 (15%)
leucine-rich repeat 216..241 CDD:275381 9/24 (38%)
leucine-rich repeat 242..267 CDD:275381 3/28 (11%)
leucine-rich repeat 268..290 CDD:275381 7/22 (32%)
Fbxl21XP_038951543.1 F-box-like 68..111 CDD:403981
leucine-rich repeat 206..231 CDD:275381
leucine-rich repeat 232..257 CDD:275381 1/1 (100%)
leucine-rich repeat 258..283 CDD:275381 10/30 (33%)
leucine-rich repeat 284..318 CDD:275381 11/45 (24%)
leucine-rich repeat 329..365 CDD:275381 7/40 (18%)
AMN1 <359..>424 CDD:187754 21/87 (24%)
leucine-rich repeat 366..392 CDD:275381 10/27 (37%)
leucine-rich repeat 393..418 CDD:275381 5/40 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.