DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment jet and FBXL22

DIOPT Version :9

Sequence 1:	NP_608880.2	Gene:	jet / 33705	FlyBaseID:	FBgn0031652	Length:	319	Species:	Drosophila melanogaster
Sequence 2:	XP_011519770.1	Gene:	FBXL22 / 283807	HGNCID:	27537	Length:	260	Species:	Homo sapiens

Alignment Length:	110	Identity:	30/110 - (27%)
Similarity:	43/110 - (39%)	Gaps:	9/110 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   190 LVEFDISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAIS 254
            |....:|.||.:.:.||....|...:|..|.|.|...||::.|..:....|.|:.::|..|..:|
Human   151 LASVTLSGCGHVTDDCLARLLRCCPRLRALRLENCARVTNRTLAAVAADGRALQTLHVDFCRNVS 215

  Fly   255 DYGVHALTVHCLRLRTLLIRRC---------PRVTELSLAPLRQR 290
            ..|:..|...|.||........         ||....:|..|.||
Human   216 AAGLRRLRAACPRLALRAEHSAAMLPDQPPRPRAPAAALGKLLQR 260

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
jet	NP_608880.2	leucine-rich repeat	85..110	CDD:275381
		AMN1	96..>261	CDD:187754	20/70 (29%)
		leucine-rich repeat	111..137	CDD:275381
		leucine-rich repeat	138..163	CDD:275381
		leucine-rich repeat	164..189	CDD:275381
		leucine-rich repeat	190..215	CDD:275381	7/24 (29%)
		leucine-rich repeat	216..241	CDD:275381	7/24 (29%)
		leucine-rich repeat	242..267	CDD:275381	7/24 (29%)
		leucine-rich repeat	268..290	CDD:275381	5/30 (17%)
FBXL22	XP_011519770.1	AMN1	<148..229	CDD:187754	22/77 (29%)
		leucine-rich repeat	151..176	CDD:275381	7/24 (29%)
		leucine-rich repeat	177..202	CDD:275381	7/24 (29%)
		leucine-rich repeat	203..228	CDD:275381	7/24 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1947
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900