Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001265645.1 | Gene: | FBXL4 / 26235 | HGNCID: | 13601 | Length: | 621 | Species: | Homo sapiens |
Alignment Length: | 269 | Identity: | 66/269 - (24%) |
---|---|---|---|
Similarity: | 100/269 - (37%) | Gaps: | 86/269 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 LIPQVAVYLSLKDLFNL---------RCC-----------------SRTAQRFVEAALEKRQELH 88
Fly 89 LSGNNTKN-IDVA--FRVLARCCQRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNIT 150
Fly 151 ALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNK 215
Fly 216 LTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHA--LTVHCLRLRTLLIRRCPR 278
Fly 279 VTELSLAPL 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 10/27 (37%) |
AMN1 | 96..>261 | CDD:187754 | 40/169 (24%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 9/26 (35%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 10/20 (50%) | ||
FBXL4 | NP_001265645.1 | F-box-like | 280..318 | CDD:315592 | 9/30 (30%) |
leucine-rich repeat | 295..317 | CDD:275381 | 7/21 (33%) | ||
leucine-rich repeat | 318..346 | CDD:275381 | 2/27 (7%) | ||
leucine-rich repeat | 347..376 | CDD:275381 | 10/28 (36%) | ||
LRR 1 | 376..397 | 7/47 (15%) | |||
leucine-rich repeat | 377..398 | CDD:275381 | 8/47 (17%) | ||
AMN1 | 394..601 | CDD:332986 | 38/135 (28%) | ||
LRR 2 | 402..421 | 7/22 (32%) | |||
leucine-rich repeat | 403..427 | CDD:275381 | 10/27 (37%) | ||
LRR 3 | 427..448 | 4/44 (9%) | |||
leucine-rich repeat | 428..452 | CDD:275381 | 6/47 (13%) | ||
LRR 4 | 452..474 | 9/21 (43%) | |||
leucine-rich repeat | 453..480 | CDD:275381 | 9/26 (35%) | ||
LRR 5 | 480..501 | 10/21 (48%) | |||
leucine-rich repeat | 481..506 | CDD:275381 | 10/20 (50%) | ||
LRR 6 | 504..524 | ||||
leucine-rich repeat | 507..534 | CDD:275381 | |||
LRR 7 | 532..558 | ||||
leucine-rich repeat | 535..560 | CDD:275381 | |||
LRR 8 | 559..583 | ||||
leucine-rich repeat | 561..586 | CDD:275381 | |||
LRR 9 | 584..609 | ||||
leucine-rich repeat | 587..612 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |