Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001336245.1 | Gene: | FBXL2 / 25827 | HGNCID: | 13598 | Length: | 454 | Species: | Homo sapiens |
Alignment Length: | 261 | Identity: | 68/261 - (26%) |
---|---|---|---|
Similarity: | 107/261 - (40%) | Gaps: | 34/261 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 SLKDLFNLRCCSRTAQRFVEAALEKRQELHLSGNNTKNID-----------VAFRVLARCCQRLE 112
Fly 113 VLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTT 177
Fly 178 GAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCREL 242
Fly 243 EHINVIGCAAISDYGVHALTVHCLRLRTLLIRRCPRVTELSLAPLRQRRLYIDRPQPDVGLNAYN 307
Fly 308 L 308 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 9/35 (26%) |
AMN1 | 96..>261 | CDD:187754 | 47/175 (27%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 8/25 (32%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 7/21 (33%) | ||
FBXL2 | NP_001336245.1 | F-box-like | 15..56 | CDD:315592 | 8/38 (21%) |
leucine-rich repeat | 52..79 | CDD:275381 | 5/26 (19%) | ||
AMN1 | <76..223 | CDD:332986 | 40/147 (27%) | ||
leucine-rich repeat | 80..99 | CDD:275381 | 6/19 (32%) | ||
leucine-rich repeat | 106..131 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 132..157 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 158..183 | CDD:275381 | 5/24 (21%) | ||
AMN1 | 168..398 | CDD:332986 | 32/109 (29%) | ||
leucine-rich repeat | 184..209 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 210..235 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 236..261 | CDD:275381 | 10/38 (26%) | ||
leucine-rich repeat | 262..287 | CDD:275381 | 1/1 (100%) | ||
leucine-rich repeat | 288..313 | CDD:275381 | |||
leucine-rich repeat | 314..364 | CDD:275381 | |||
leucine-rich repeat | 374..393 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |