| Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036436.1 | Gene: | FBXL7 / 23194 | HGNCID: | 13604 | Length: | 491 | Species: | Homo sapiens |
| Alignment Length: | 369 | Identity: | 87/369 - (23%) |
|---|---|---|---|
| Similarity: | 145/369 - (39%) | Gaps: | 96/369 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 13 MAMASGGQPTRTASPRPLVTASIAAPRSLFDVCWDDVLIPQVAVYLSLKDLFNLRC-CSRTAQRF 76
Fly 77 VEAALEKR--QELHLSGNNTKNIDVAFRVLAR--C------CQRLEVLHLACCRWLTDELLLPL- 130
Fly 131 ---------------------------LANNKKRLWAVNLNECVNITALS--------------- 153
Fly 154 -------------------LQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCG 199
Fly 200 AIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVH 264
Fly 265 CLRLRTLLIRRCPRVTELSLAPLRQRRLYIDRPQPDVGLNAYNL 308 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 11/32 (34%) |
| AMN1 | 96..>261 | CDD:187754 | 53/234 (23%) | ||
| leucine-rich repeat | 111..137 | CDD:275381 | 10/53 (19%) | ||
| leucine-rich repeat | 138..163 | CDD:275381 | 7/58 (12%) | ||
| leucine-rich repeat | 164..189 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 190..215 | CDD:275381 | 4/24 (17%) | ||
| leucine-rich repeat | 216..241 | CDD:275381 | 9/24 (38%) | ||
| leucine-rich repeat | 242..267 | CDD:275381 | 10/24 (42%) | ||
| leucine-rich repeat | 268..290 | CDD:275381 | 8/21 (38%) | ||
| FBXL7 | NP_036436.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..79 | ||
| F-box-like | 114..157 | CDD:372399 | 11/47 (23%) | ||
| leucine-rich repeat | 129..151 | CDD:275381 | 7/25 (28%) | ||
| leucine-rich repeat | 154..187 | CDD:275381 | 11/33 (33%) | ||
| LRR 1 | 170..195 | 7/24 (29%) | |||
| AMN1 | <185..366 | CDD:187754 | 35/183 (19%) | ||
| leucine-rich repeat | 188..213 | CDD:275381 | 8/24 (33%) | ||
| LRR 2 | 196..221 | 6/24 (25%) | |||
| leucine-rich repeat | 214..234 | CDD:275381 | 0/19 (0%) | ||
| LRR 3 | 222..247 | 3/27 (11%) | |||
| leucine-rich repeat | 240..273 | CDD:275381 | 4/35 (11%) | ||
| LRR 4 | 253..281 | 1/27 (4%) | |||
| leucine-rich repeat | 274..299 | CDD:275381 | 3/24 (13%) | ||
| LRR 5 | 282..307 | 6/24 (25%) | |||
| AMN1 | 297..464 | CDD:187754 | 43/148 (29%) | ||
| leucine-rich repeat | 300..325 | CDD:275381 | 7/24 (29%) | ||
| LRR 6 | 308..333 | 5/24 (21%) | |||
| leucine-rich repeat | 326..351 | CDD:275381 | 4/24 (17%) | ||
| LRR 7 | 334..359 | 5/24 (21%) | |||
| leucine-rich repeat | 352..377 | CDD:275381 | 9/24 (38%) | ||
| LRR 8 | 360..385 | 7/24 (29%) | |||
| leucine-rich repeat | 378..403 | CDD:275381 | 10/24 (42%) | ||
| LRR 9 | 386..411 | 10/24 (42%) | |||
| leucine-rich repeat | 404..429 | CDD:275381 | 10/38 (26%) | ||
| LRR 10 | 412..437 | 9/33 (27%) | |||
| leucine-rich repeat | 430..453 | CDD:275381 | 1/1 (100%) | ||
| LRR 11 | 438..463 | ||||
| leucine-rich repeat | 456..480 | CDD:275381 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||