DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and KDM2A

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_036440.1 Gene:KDM2A / 22992 HGNCID:13606 Length:1162 Species:Homo sapiens


Alignment Length:356 Identity:79/356 - (22%)
Similarity:124/356 - (34%) Gaps:139/356 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NLR---------CCSRTAQRFVEAAL--------EKRQE---------LHLSGNNTKNID----- 98
            |||         |.:||.||..|..|        |:.:|         ..|:|..:...|     
Human   828 NLRHSPRVLVQHCPARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESW 892

  Fly    99 -------VAFRVLAR--CCQRLEVLHLACC----RWLTDELLLPLLANNKKRLWA-VNLNECVNI 149
                   ..||.|:|  .|:.:.|     |    :|..|           ||||. ::|:.|..|
Human   893 MQREVWMSVFRYLSRRELCECMRV-----CKTWYKWCCD-----------KRLWTKIDLSRCKAI 941

  Fly   150 TALSL------QPIIVECK-----------------ELRVLKLSKCQWLTTGAV----------- 180
            ...:|      ||:.::..                 .|:.|.|:.|.|....|:           
Human   942 VPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTL 1006

  Fly   181 --------------DALTL--------HQSKLVEF-DISYCGA-IGERCLIIFFRKLNKLTVLSL 221
                          |.||.        ::|||... |....|. |.:..|.:..|.:..|:.|.|
Human  1007 DLRWAVGIKDPQIRDLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDL 1071

  Fly   222 ANTPSVTDQ---VLIQIGNYCR-ELEHINVIGCAAISDYGVHALTVHCLRLRTLL-IRRCPRVTE 281
            ::...:|||   :|..:|:..| .|..:|:.||..::|             :||: :||...||.
Human  1072 SHCSHLTDQSSNLLTAVGSSTRYSLTELNMAGCNKLTD-------------QTLIYLRRIANVTL 1123

  Fly   282 LSLAPLRQ-RRLYIDRPQPDVGLNA-YNLND 310
            :.|...:| .|...:....|:.:|: |.|:|
Human  1124 IDLRGCKQITRKACEHFISDLSINSLYCLSD 1154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 9/47 (19%)
AMN1 96..>261 CDD:187754 51/245 (21%)
leucine-rich repeat 111..137 CDD:275381 4/29 (14%)
leucine-rich repeat 138..163 CDD:275381 8/48 (17%)
leucine-rich repeat 164..189 CDD:275381 9/57 (16%)
leucine-rich repeat 190..215 CDD:275381 6/26 (23%)
leucine-rich repeat 216..241 CDD:275381 9/28 (32%)
leucine-rich repeat 242..267 CDD:275381 5/24 (21%)
leucine-rich repeat 268..290 CDD:275381 8/23 (35%)
KDM2ANP_036440.1 cupin_like 199..299 CDD:328732
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..389
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..557
zf-CXXC <576..609 CDD:251032
PHD_KDM2A 619..675 CDD:277113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 839..887 11/47 (23%)
F-box-like 896..934 CDD:315592 13/53 (25%)
leucine-rich repeat 930..954 CDD:275381 5/23 (22%)
AMN1 932..1138 CDD:332986 46/218 (21%)
leucine-rich repeat 955..978 CDD:275381 0/22 (0%)
LRR 1 961..982 1/20 (5%)
leucine-rich repeat 979..1002 CDD:275381 6/22 (27%)
LRR 2 984..1010 4/25 (16%)
leucine-rich repeat 1003..1040 CDD:275381 6/36 (17%)
leucine-rich repeat 1041..1065 CDD:275381 5/23 (22%)
LRR 3 1048..1073 7/24 (29%)
leucine-rich repeat 1066..1095 CDD:275381 9/28 (32%)
LRR 4 1074..1103 8/28 (29%)
leucine-rich repeat 1096..1120 CDD:275381 9/36 (25%)
LRR 5 1104..1128 9/36 (25%)
leucine-rich repeat 1121..1140 CDD:275381 5/18 (28%)
LRR 6 1129..1156 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.