DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and FBXL13

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001381423.1 Gene:FBXL13 / 222235 HGNCID:21658 Length:825 Species:Homo sapiens


Alignment Length:289 Identity:72/289 - (24%)
Similarity:127/289 - (43%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VYLSLKDLFNL--RC-------CSR-TAQRFVEA---------ALE--KRQELHLSGNNTKNIDV 99
            ::|::.|:..|  .|       ||| |:..|..|         ||.  |.:::...||. :..|.
Human   443 MHLTINDMPTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFRALSACKLRKIRFEGNK-RVTDA 506

  Fly   100 AFRVLARCCQRLEVLHLACCRWLTDELLLPL----------LAN----------------NKKRL 138
            :|:.:.:....|..:::|.|:.:||..|..|          |||                ...|:
Human   507 SFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMRI 571

  Fly   139 WAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGE 203
            ..:||:.||.::..|:..:...|..|..|.|..|:.||...:..: ::...||..|:|......|
Human   572 RELNLSNCVRLSDASVMKLSERCPNLNYLSLRNCEHLTAQGIGYI-VNIFSLVSIDLSGTDISNE 635

  Fly   204 RCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRE---LEHINVIGCAAISDYGVHALTVHC 265
            ...::...|  ||..||::....:||.   .|..:|:.   |||::|..|:.:||..:.||.::|
Human   636 GLNVLSRHK--KLKELSVSECYRITDD---GIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYC 695

  Fly   266 LRLRTLLIRRCPRVTELSLAPLRQRRLYI 294
            :.|.:|.|..||::|:.::..|..:..|:
Human   696 INLTSLSIAGCPKITDSAMEMLSAKCHYL 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 4/24 (17%)
AMN1 96..>261 CDD:187754 46/193 (24%)
leucine-rich repeat 111..137 CDD:275381 10/51 (20%)
leucine-rich repeat 138..163 CDD:275381 6/24 (25%)
leucine-rich repeat 164..189 CDD:275381 6/24 (25%)
leucine-rich repeat 190..215 CDD:275381 6/24 (25%)
leucine-rich repeat 216..241 CDD:275381 7/24 (29%)
leucine-rich repeat 242..267 CDD:275381 10/24 (42%)
leucine-rich repeat 268..290 CDD:275381 7/21 (33%)
FBXL13NP_001381423.1 Sfi1 <112..>224 CDD:400658
F-box-like 245..289 CDD:403981
leucine-rich repeat 285..312 CDD:275381
AMN1 312..497 CDD:187754 13/53 (25%)
leucine-rich repeat 313..336 CDD:275381
leucine-rich repeat 337..362 CDD:275381
leucine-rich repeat 363..387 CDD:275381
leucine-rich repeat 388..406 CDD:275381
leucine-rich repeat 416..441 CDD:275381
leucine-rich repeat 442..491 CDD:275381 12/47 (26%)
leucine-rich repeat 468..490 CDD:275381 5/21 (24%)
leucine-rich repeat 492..515 CDD:275381 4/23 (17%)
leucine-rich repeat 518..542 CDD:275381 7/23 (30%)
AMN1 529..737 CDD:187754 52/202 (26%)
leucine-rich repeat 543..570 CDD:275381 3/26 (12%)
leucine-rich repeat 571..596 CDD:275381 6/24 (25%)
leucine-rich repeat 597..645 CDD:275381 12/50 (24%)
leucine-rich repeat 646..671 CDD:275381 7/27 (26%)
leucine-rich repeat 672..697 CDD:275381 10/24 (42%)
leucine-rich repeat 698..723 CDD:275381 7/24 (29%)
leucine-rich repeat 724..749 CDD:275381 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.