Sequence 1: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001366323.1 | Gene: | Fbxl16 / 214931 | MGIID: | 2448488 | Length: | 575 | Species: | Mus musculus |
Alignment Length: | 245 | Identity: | 61/245 - (24%) |
---|---|---|---|
Similarity: | 92/245 - (37%) | Gaps: | 41/245 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 VEAALEKRQ---ELHLSGNN--------------------TKNIDVAFRVLARCCQ--------R 110
Fly 111 LEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWL 175
Fly 176 TTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCR 240
Fly 241 ELEHINVIGCAAISDYGV-HALTVHCLRLRTLLIRRCPRVTELSLAPLRQ 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | 11/55 (20%) |
AMN1 | 96..>261 | CDD:187754 | 41/173 (24%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 6/25 (24%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 6/25 (24%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 8/22 (36%) | ||
Fbxl16 | NP_001366323.1 | PHA03247 | <31..193 | CDD:223021 | |
AMN1 | 297..509 | CDD:187754 | 47/209 (22%) | ||
leucine-rich repeat | 316..339 | CDD:275381 | 5/22 (23%) | ||
leucine-rich repeat | 340..365 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 366..391 | CDD:275381 | 6/30 (20%) | ||
leucine-rich repeat | 392..417 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 418..443 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 444..469 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 470..494 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 495..514 | CDD:275381 | 4/18 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR13318 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |