DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jet and AMN1

DIOPT Version :9

Sequence 1:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001106873.1 Gene:AMN1 / 196394 HGNCID:27281 Length:258 Species:Homo sapiens


Alignment Length:191 Identity:54/191 - (28%)
Similarity:90/191 - (47%) Gaps:17/191 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EVLH-------LACCRWLTDELLLPLLANNKKRLWAVNLNEC----VNITALSLQPIIVECKELR 165
            |:||       |..|. ::|..||.|  :|.::|..:|||..    |::|:..::.:...|..|.
Human    57 EILHPEVQTLDLRSCD-ISDAALLHL--SNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLH 118

  Fly   166 VLKLSKCQWLTTGAVDALTLHQSKLVEFDISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQ 230
            ...|.:|..||...|.||.|:...|...|:..|.:|.:..|....:....|..:..:.| .|:|.
Human   119 EASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSAT-QVSDS 182

  Fly   231 VLIQI--GNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRCPRVTELSLAPLRQ 289
            .:|.:  |...::||.|::..|..::|..|.|:..:|.::|.||...||.:|:.|...|.|
Human   183 GVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381
AMN1 96..>261 CDD:187754 43/161 (27%)
leucine-rich repeat 111..137 CDD:275381 10/31 (32%)
leucine-rich repeat 138..163 CDD:275381 7/28 (25%)
leucine-rich repeat 164..189 CDD:275381 9/24 (38%)
leucine-rich repeat 190..215 CDD:275381 5/24 (21%)
leucine-rich repeat 216..241 CDD:275381 6/26 (23%)
leucine-rich repeat 242..267 CDD:275381 8/24 (33%)
leucine-rich repeat 268..290 CDD:275381 9/22 (41%)
AMN1NP_001106873.1 AMN1 37..257 CDD:187754 54/191 (28%)
leucine-rich repeat 63..86 CDD:275381 7/25 (28%)
leucine-rich repeat 87..116 CDD:275381 7/28 (25%)
leucine-rich repeat 117..142 CDD:275381 9/24 (38%)
leucine-rich repeat 143..168 CDD:275381 5/24 (21%)
leucine-rich repeat 169..195 CDD:275381 6/26 (23%)
leucine-rich repeat 196..221 CDD:275381 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.